Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168KTW7

Protein Details
Accession A0A168KTW7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
87-109VYKDSKCTQRTKDKPFNYKPGYYHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 25
Family & Domain DBs
Amino Acid Sequences MKLLSLSLIPLGCLYLAQLTQAQPDVGDQSGNVSEDAKAASTKGRVEVLYTGTGHYDRARMGQCIPVRSGSKQLIGLFFSHPTQCFVYKDSKCTQRTKDKPFNYKPGYYKPAVSQGYGSCHDIRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.07
4 0.08
5 0.1
6 0.1
7 0.12
8 0.13
9 0.12
10 0.1
11 0.11
12 0.12
13 0.1
14 0.09
15 0.08
16 0.09
17 0.1
18 0.11
19 0.1
20 0.09
21 0.09
22 0.09
23 0.1
24 0.08
25 0.07
26 0.07
27 0.09
28 0.1
29 0.11
30 0.12
31 0.13
32 0.13
33 0.14
34 0.15
35 0.15
36 0.15
37 0.14
38 0.13
39 0.12
40 0.12
41 0.12
42 0.11
43 0.09
44 0.08
45 0.11
46 0.12
47 0.12
48 0.13
49 0.18
50 0.19
51 0.19
52 0.2
53 0.2
54 0.2
55 0.2
56 0.25
57 0.21
58 0.2
59 0.21
60 0.21
61 0.19
62 0.18
63 0.19
64 0.15
65 0.15
66 0.14
67 0.13
68 0.13
69 0.14
70 0.15
71 0.16
72 0.16
73 0.18
74 0.26
75 0.26
76 0.31
77 0.35
78 0.42
79 0.45
80 0.51
81 0.57
82 0.59
83 0.67
84 0.72
85 0.76
86 0.76
87 0.82
88 0.83
89 0.85
90 0.8
91 0.78
92 0.74
93 0.73
94 0.7
95 0.61
96 0.57
97 0.5
98 0.53
99 0.47
100 0.42
101 0.37
102 0.33
103 0.37
104 0.36
105 0.36