Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168KYV5

Protein Details
Accession A0A168KYV5   
Localization Confidence Medium
Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
73-98VNGKNKRDEEAKKKQRKEFKATLVDGHydrophilic
NLS Segment(s)
PositionSequence
79-89RDEEAKKKQRK
Subcellular Location(s) mito 14.5, mito_nucl 12.333, nucl 9, cyto_nucl 6.333
Family & Domain DBs
Amino Acid Sequences MRGFLHVFRKLLSPIPDPSPCPSSPASREPISVAITIDLQRKRRVMTQKVNVSQGKQKVDKLRTSRLWCYGIVNGKNKRDEEAKKKQRKEFKATLVDGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.36
3 0.38
4 0.37
5 0.39
6 0.38
7 0.33
8 0.33
9 0.31
10 0.31
11 0.33
12 0.36
13 0.37
14 0.33
15 0.34
16 0.32
17 0.32
18 0.28
19 0.23
20 0.18
21 0.13
22 0.13
23 0.15
24 0.19
25 0.2
26 0.21
27 0.24
28 0.25
29 0.26
30 0.31
31 0.38
32 0.41
33 0.47
34 0.53
35 0.58
36 0.59
37 0.63
38 0.58
39 0.51
40 0.48
41 0.43
42 0.4
43 0.34
44 0.36
45 0.38
46 0.42
47 0.47
48 0.47
49 0.51
50 0.53
51 0.57
52 0.56
53 0.53
54 0.51
55 0.44
56 0.41
57 0.38
58 0.38
59 0.38
60 0.42
61 0.43
62 0.47
63 0.51
64 0.49
65 0.48
66 0.48
67 0.52
68 0.54
69 0.59
70 0.64
71 0.7
72 0.78
73 0.83
74 0.85
75 0.85
76 0.85
77 0.83
78 0.82
79 0.81