Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168SD84

Protein Details
Accession A0A168SD84    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
111-134EVNPSFPHQKKRQQEQQQKQLLRQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 14, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR015633  E2F  
IPR003316  E2F_WHTH_DNA-bd_dom  
IPR036388  WH-like_DNA-bd_sf  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0005667  C:transcription regulator complex  
GO:0000978  F:RNA polymerase II cis-regulatory region sequence-specific DNA binding  
GO:0006357  P:regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF02319  E2F_TDP  
Amino Acid Sequences MMAKDGKPHESPPSTSLDTPCSSSTPSPSPSSSSPATLSATSSRYDSSLSLLTKKFIKMIVSTSGDIDLKQAAILLNVQKRRIYDITNVLEGIHLIEKVSKNHVSGNQVKEVNPSFPHQKKRQQEQQQKQLLRQQKLERLRKLKSANKELELEHEKLTSFYRVIQHIHPIHQLSPKIYLRIPLPFTRMTTQGYANKATAFIYHSLFLVLSFHAIMKFSKKKLFQSKTVEDNDVLSHHFKEQCELQRRINATMPHLRSHHHQNQPFVCIKANGAIVFNRSHHTSIPSEWKDDESDEEETICTYSPPDDLPSNGSSSLSSFESLADFSAHLSDSHLSRSTSLPSVLPRKLPSSSPKFHTETYQLTYEQKIGILLEEMDDVQQESFCMKKKYQALEQRCQRLEQRLAQRDQLILDLQSQLESFVHSPTE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.45
3 0.44
4 0.4
5 0.37
6 0.36
7 0.35
8 0.3
9 0.29
10 0.29
11 0.32
12 0.32
13 0.35
14 0.36
15 0.36
16 0.39
17 0.38
18 0.41
19 0.37
20 0.34
21 0.31
22 0.29
23 0.3
24 0.26
25 0.26
26 0.24
27 0.24
28 0.22
29 0.21
30 0.2
31 0.18
32 0.19
33 0.16
34 0.16
35 0.2
36 0.21
37 0.26
38 0.26
39 0.28
40 0.31
41 0.31
42 0.3
43 0.27
44 0.28
45 0.24
46 0.27
47 0.31
48 0.31
49 0.3
50 0.29
51 0.29
52 0.26
53 0.24
54 0.21
55 0.15
56 0.11
57 0.1
58 0.1
59 0.08
60 0.08
61 0.11
62 0.16
63 0.22
64 0.26
65 0.28
66 0.29
67 0.29
68 0.35
69 0.35
70 0.32
71 0.32
72 0.38
73 0.4
74 0.39
75 0.38
76 0.32
77 0.29
78 0.25
79 0.2
80 0.12
81 0.08
82 0.07
83 0.12
84 0.14
85 0.16
86 0.22
87 0.22
88 0.22
89 0.27
90 0.31
91 0.34
92 0.39
93 0.41
94 0.42
95 0.42
96 0.42
97 0.42
98 0.4
99 0.35
100 0.3
101 0.29
102 0.32
103 0.37
104 0.46
105 0.5
106 0.57
107 0.63
108 0.71
109 0.78
110 0.8
111 0.84
112 0.85
113 0.87
114 0.87
115 0.8
116 0.74
117 0.72
118 0.69
119 0.63
120 0.6
121 0.56
122 0.55
123 0.63
124 0.68
125 0.69
126 0.67
127 0.66
128 0.66
129 0.68
130 0.66
131 0.65
132 0.66
133 0.62
134 0.58
135 0.57
136 0.5
137 0.49
138 0.46
139 0.39
140 0.3
141 0.26
142 0.23
143 0.21
144 0.22
145 0.16
146 0.12
147 0.13
148 0.16
149 0.18
150 0.2
151 0.2
152 0.27
153 0.28
154 0.29
155 0.29
156 0.27
157 0.28
158 0.29
159 0.29
160 0.22
161 0.28
162 0.27
163 0.26
164 0.25
165 0.24
166 0.22
167 0.25
168 0.28
169 0.22
170 0.25
171 0.24
172 0.26
173 0.25
174 0.25
175 0.22
176 0.21
177 0.23
178 0.24
179 0.25
180 0.24
181 0.23
182 0.21
183 0.19
184 0.17
185 0.14
186 0.11
187 0.11
188 0.1
189 0.1
190 0.1
191 0.1
192 0.09
193 0.08
194 0.07
195 0.05
196 0.05
197 0.05
198 0.05
199 0.05
200 0.06
201 0.06
202 0.12
203 0.16
204 0.19
205 0.24
206 0.27
207 0.35
208 0.45
209 0.49
210 0.5
211 0.55
212 0.57
213 0.59
214 0.59
215 0.52
216 0.41
217 0.38
218 0.3
219 0.22
220 0.19
221 0.13
222 0.11
223 0.13
224 0.15
225 0.14
226 0.16
227 0.21
228 0.28
229 0.35
230 0.38
231 0.38
232 0.4
233 0.42
234 0.43
235 0.41
236 0.34
237 0.31
238 0.36
239 0.35
240 0.33
241 0.32
242 0.31
243 0.31
244 0.39
245 0.43
246 0.43
247 0.45
248 0.48
249 0.5
250 0.53
251 0.52
252 0.43
253 0.35
254 0.27
255 0.24
256 0.2
257 0.19
258 0.14
259 0.13
260 0.13
261 0.14
262 0.15
263 0.15
264 0.14
265 0.15
266 0.16
267 0.15
268 0.18
269 0.18
270 0.2
271 0.3
272 0.29
273 0.29
274 0.29
275 0.3
276 0.27
277 0.26
278 0.25
279 0.18
280 0.19
281 0.17
282 0.16
283 0.15
284 0.14
285 0.13
286 0.1
287 0.07
288 0.06
289 0.06
290 0.07
291 0.08
292 0.11
293 0.11
294 0.12
295 0.16
296 0.17
297 0.18
298 0.17
299 0.17
300 0.14
301 0.14
302 0.15
303 0.12
304 0.11
305 0.1
306 0.1
307 0.1
308 0.1
309 0.1
310 0.08
311 0.07
312 0.07
313 0.08
314 0.08
315 0.07
316 0.09
317 0.1
318 0.11
319 0.14
320 0.16
321 0.15
322 0.17
323 0.18
324 0.2
325 0.2
326 0.21
327 0.2
328 0.24
329 0.31
330 0.32
331 0.34
332 0.34
333 0.35
334 0.36
335 0.4
336 0.43
337 0.45
338 0.48
339 0.49
340 0.53
341 0.53
342 0.53
343 0.53
344 0.48
345 0.45
346 0.43
347 0.41
348 0.36
349 0.34
350 0.34
351 0.31
352 0.26
353 0.21
354 0.17
355 0.14
356 0.13
357 0.12
358 0.1
359 0.09
360 0.09
361 0.09
362 0.08
363 0.08
364 0.08
365 0.07
366 0.07
367 0.07
368 0.08
369 0.11
370 0.16
371 0.21
372 0.22
373 0.29
374 0.37
375 0.44
376 0.53
377 0.6
378 0.64
379 0.7
380 0.78
381 0.8
382 0.74
383 0.71
384 0.66
385 0.65
386 0.64
387 0.62
388 0.64
389 0.63
390 0.65
391 0.66
392 0.63
393 0.55
394 0.49
395 0.42
396 0.33
397 0.24
398 0.23
399 0.2
400 0.17
401 0.16
402 0.15
403 0.14
404 0.12
405 0.14
406 0.13