Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168PNB4

Protein Details
Accession A0A168PNB4   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MGDLKQWSSRHRRHRRRYCRSHRRSGSNVERBasic
NLS Segment(s)
PositionSequence
10-18RHRRHRRRY
Subcellular Location(s) nucl 19.5, mito_nucl 13, mito 5.5
Family & Domain DBs
Amino Acid Sequences MGDLKQWSSRHRRHRRRYCRSHRRSGSNVERKMKAIVNHVRYQCRCQNKSDEEAKKKQQKGIDRKVILVAISGFEIPV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.93
3 0.94
4 0.96
5 0.96
6 0.96
7 0.94
8 0.94
9 0.91
10 0.88
11 0.82
12 0.8
13 0.8
14 0.78
15 0.77
16 0.71
17 0.64
18 0.56
19 0.54
20 0.47
21 0.38
22 0.37
23 0.37
24 0.37
25 0.41
26 0.43
27 0.46
28 0.44
29 0.47
30 0.45
31 0.47
32 0.44
33 0.42
34 0.48
35 0.46
36 0.52
37 0.56
38 0.59
39 0.58
40 0.63
41 0.69
42 0.7
43 0.7
44 0.67
45 0.64
46 0.65
47 0.68
48 0.71
49 0.71
50 0.64
51 0.62
52 0.59
53 0.54
54 0.44
55 0.34
56 0.24
57 0.15
58 0.14