Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168MH10

Protein Details
Accession A0A168MH10   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
72-101LLDEKKQKQKTTKPVHRQFHRKQNRDAIKLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MIITLARPSLRRHSQRSFIHASSWVSQSVPEVPRKPSSVPAGVTLKGINFLKDGTDPVALEDTAYPMWLWDLLDEKKQKQKTTKPVHRQFHRKQNRDAIKLSNFMKDKKT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.69
3 0.72
4 0.69
5 0.6
6 0.55
7 0.5
8 0.46
9 0.39
10 0.35
11 0.28
12 0.21
13 0.2
14 0.19
15 0.21
16 0.22
17 0.24
18 0.26
19 0.28
20 0.32
21 0.34
22 0.34
23 0.33
24 0.34
25 0.32
26 0.3
27 0.32
28 0.31
29 0.28
30 0.27
31 0.22
32 0.17
33 0.17
34 0.16
35 0.12
36 0.09
37 0.09
38 0.09
39 0.09
40 0.1
41 0.08
42 0.08
43 0.08
44 0.08
45 0.09
46 0.08
47 0.08
48 0.07
49 0.07
50 0.06
51 0.06
52 0.05
53 0.04
54 0.05
55 0.05
56 0.05
57 0.04
58 0.09
59 0.1
60 0.17
61 0.2
62 0.24
63 0.32
64 0.36
65 0.42
66 0.47
67 0.55
68 0.6
69 0.68
70 0.75
71 0.78
72 0.84
73 0.89
74 0.89
75 0.91
76 0.89
77 0.89
78 0.89
79 0.85
80 0.84
81 0.84
82 0.84
83 0.79
84 0.73
85 0.7
86 0.64
87 0.63
88 0.57
89 0.55
90 0.48