Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A163MI38

Protein Details
Accession A0A163MI38    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
40-67QKEPAQHDHRNRTQRRRRKMLPAQQVFAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito 6, cyto 6, cyto_mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR022210  TF_GCR1-like  
Gene Ontology GO:0110165  C:cellular anatomical entity  
Pfam View protein in Pfam  
PF12550  GCR1_C  
Amino Acid Sequences MSRGIKTITDLYRNWYDGLAGGYPVETLERQWGTKWREDQKEPAQHDHRNRTQRRRRKMLPAQQVFAPSFRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.28
3 0.23
4 0.19
5 0.21
6 0.15
7 0.1
8 0.08
9 0.08
10 0.07
11 0.07
12 0.07
13 0.05
14 0.05
15 0.1
16 0.11
17 0.11
18 0.13
19 0.2
20 0.22
21 0.27
22 0.33
23 0.36
24 0.41
25 0.43
26 0.49
27 0.51
28 0.56
29 0.55
30 0.56
31 0.55
32 0.56
33 0.61
34 0.63
35 0.62
36 0.64
37 0.7
38 0.73
39 0.78
40 0.81
41 0.84
42 0.85
43 0.84
44 0.85
45 0.87
46 0.86
47 0.87
48 0.84
49 0.76
50 0.69
51 0.66
52 0.56