Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168L3K7

Protein Details
Accession A0A168L3K7   
Localization Confidence Low
Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
20-41INYKGLKKRLRWVDKFRKSNEHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 11.5, cyto_nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004331  SPX_dom  
Pfam View protein in Pfam  
PF03105  SPX  
PROSITE View protein in PROSITE  
PS51382  SPX  
Amino Acid Sequences MKFAKCLETDSIPEWRRAYINYKGLKKRLRWVDKFRKSNEHKAALELAQMFQDASVAEEDDTDHRAWWNPWPLHRPSSLSLLRQWTSKKNVMDTTLSPRPGTFKPRQTIQLIRFSSTQCLSIVP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.32
3 0.3
4 0.31
5 0.34
6 0.33
7 0.39
8 0.44
9 0.52
10 0.57
11 0.63
12 0.67
13 0.65
14 0.66
15 0.69
16 0.71
17 0.71
18 0.75
19 0.78
20 0.81
21 0.85
22 0.8
23 0.8
24 0.76
25 0.78
26 0.75
27 0.71
28 0.61
29 0.55
30 0.53
31 0.42
32 0.38
33 0.28
34 0.19
35 0.12
36 0.12
37 0.09
38 0.07
39 0.07
40 0.04
41 0.04
42 0.04
43 0.04
44 0.04
45 0.04
46 0.05
47 0.06
48 0.08
49 0.07
50 0.07
51 0.07
52 0.09
53 0.09
54 0.14
55 0.21
56 0.21
57 0.25
58 0.3
59 0.33
60 0.34
61 0.35
62 0.34
63 0.27
64 0.34
65 0.33
66 0.29
67 0.3
68 0.32
69 0.32
70 0.32
71 0.33
72 0.31
73 0.35
74 0.4
75 0.39
76 0.38
77 0.4
78 0.4
79 0.41
80 0.37
81 0.39
82 0.38
83 0.37
84 0.33
85 0.3
86 0.32
87 0.32
88 0.38
89 0.38
90 0.41
91 0.46
92 0.51
93 0.56
94 0.58
95 0.63
96 0.6
97 0.61
98 0.54
99 0.51
100 0.48
101 0.45
102 0.44
103 0.37
104 0.33