Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C1GA20

Protein Details
Accession C1GA20    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
129-159YCCMTRPGERVAKRRRCKSKIGSSHKINQTEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 6.5, cyto_nucl 6, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002132  Ribosomal_L5  
IPR031309  Ribosomal_L5_C  
IPR020929  Ribosomal_L5_CS  
IPR022803  Ribosomal_L5_dom_sf  
IPR031310  Ribosomal_L5_N  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG pbn:PADG_04106  -  
Pfam View protein in Pfam  
PF00281  Ribosomal_L5  
PF00673  Ribosomal_L5_C  
PROSITE View protein in PROSITE  
PS00358  RIBOSOMAL_L5  
Amino Acid Sequences MAEGKKSNPMRELRIQKLVLNISVGESGDRLTRAAKVLEQLSGQTPVYSKARYTVRTFGIRRNEKIAVHVTVRGPKAEEILERGLKVKEYELRKQNFSETGNFGFGISEHIDLGIKYDPGIGIYGMDFYCCMTRPGERVAKRRRCKSKIGSSHKINQTETIKWFKSRFEGIVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.6
3 0.55
4 0.56
5 0.51
6 0.42
7 0.34
8 0.28
9 0.21
10 0.2
11 0.18
12 0.12
13 0.1
14 0.1
15 0.1
16 0.1
17 0.09
18 0.09
19 0.11
20 0.13
21 0.14
22 0.14
23 0.16
24 0.17
25 0.18
26 0.17
27 0.17
28 0.17
29 0.18
30 0.17
31 0.13
32 0.13
33 0.15
34 0.17
35 0.17
36 0.15
37 0.19
38 0.24
39 0.27
40 0.31
41 0.33
42 0.35
43 0.43
44 0.44
45 0.45
46 0.5
47 0.52
48 0.5
49 0.49
50 0.47
51 0.39
52 0.41
53 0.37
54 0.3
55 0.25
56 0.26
57 0.22
58 0.24
59 0.25
60 0.22
61 0.19
62 0.17
63 0.17
64 0.15
65 0.14
66 0.12
67 0.15
68 0.15
69 0.14
70 0.16
71 0.15
72 0.14
73 0.14
74 0.13
75 0.15
76 0.19
77 0.26
78 0.32
79 0.35
80 0.36
81 0.37
82 0.37
83 0.35
84 0.33
85 0.29
86 0.24
87 0.23
88 0.21
89 0.2
90 0.18
91 0.14
92 0.12
93 0.12
94 0.1
95 0.08
96 0.07
97 0.08
98 0.08
99 0.08
100 0.1
101 0.08
102 0.07
103 0.07
104 0.07
105 0.07
106 0.07
107 0.08
108 0.06
109 0.05
110 0.05
111 0.07
112 0.06
113 0.07
114 0.06
115 0.06
116 0.08
117 0.08
118 0.09
119 0.09
120 0.12
121 0.14
122 0.22
123 0.3
124 0.36
125 0.46
126 0.55
127 0.65
128 0.72
129 0.8
130 0.83
131 0.8
132 0.83
133 0.84
134 0.84
135 0.84
136 0.84
137 0.84
138 0.8
139 0.85
140 0.82
141 0.77
142 0.67
143 0.64
144 0.59
145 0.54
146 0.53
147 0.51
148 0.46
149 0.47
150 0.47
151 0.43
152 0.45
153 0.45