Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168LCZ3

Protein Details
Accession A0A168LCZ3    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
27-59LKDDLRQWASRRRRRRRRRHRRSGSNGERKMKABasic
NLS Segment(s)
PositionSequence
36-57SRRRRRRRRRHRRSGSNGERKM
Subcellular Location(s) mito 13, nucl 8, cyto_nucl 8, cyto 6
Family & Domain DBs
Amino Acid Sequences MKIVSAYKKKLRGFPYVFTFEIFETALKDDLRQWASRRRRRRRRRHRRSGSNGERKMKAIINCGEQEMNRMLRRGVLPSVRRRSSFVVLVVVFSARRMSVEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.61
3 0.57
4 0.53
5 0.46
6 0.42
7 0.32
8 0.28
9 0.22
10 0.14
11 0.11
12 0.11
13 0.13
14 0.11
15 0.12
16 0.12
17 0.18
18 0.2
19 0.22
20 0.24
21 0.32
22 0.42
23 0.51
24 0.6
25 0.66
26 0.75
27 0.83
28 0.91
29 0.93
30 0.94
31 0.96
32 0.96
33 0.96
34 0.96
35 0.95
36 0.94
37 0.93
38 0.92
39 0.87
40 0.8
41 0.7
42 0.6
43 0.53
44 0.45
45 0.36
46 0.32
47 0.28
48 0.27
49 0.26
50 0.27
51 0.25
52 0.21
53 0.22
54 0.19
55 0.21
56 0.19
57 0.19
58 0.18
59 0.2
60 0.21
61 0.21
62 0.23
63 0.26
64 0.32
65 0.41
66 0.51
67 0.52
68 0.52
69 0.53
70 0.54
71 0.51
72 0.48
73 0.39
74 0.36
75 0.32
76 0.31
77 0.28
78 0.23
79 0.18
80 0.15
81 0.14
82 0.08