Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A163JR60

Protein Details
Accession A0A163JR60    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
3-47DIKLLSSRSFRHRRRRYRRHRRSQSKVEKKSRRCKKQLVSQGKKMBasic
NLS Segment(s)
PositionSequence
12-39FRHRRRRYRRHRRSQSKVEKKSRRCKKQ
Subcellular Location(s) mito_nucl 13.666, nucl 13.5, mito 12.5, cyto_nucl 8.333
Family & Domain DBs
Amino Acid Sequences MGDIKLLSSRSFRHRRRRYRRHRRSQSKVEKKSRRCKKQLVSQGKKMNKMVGRVALLCIRRLRWFHRGRVVRSVMSKSIENKSDEEVKEEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.77
3 0.85
4 0.92
5 0.93
6 0.94
7 0.96
8 0.96
9 0.97
10 0.97
11 0.95
12 0.95
13 0.95
14 0.95
15 0.94
16 0.93
17 0.92
18 0.91
19 0.91
20 0.9
21 0.89
22 0.86
23 0.85
24 0.83
25 0.83
26 0.83
27 0.84
28 0.8
29 0.78
30 0.79
31 0.73
32 0.69
33 0.59
34 0.55
35 0.46
36 0.41
37 0.35
38 0.29
39 0.27
40 0.23
41 0.24
42 0.22
43 0.21
44 0.21
45 0.2
46 0.19
47 0.22
48 0.25
49 0.28
50 0.34
51 0.4
52 0.44
53 0.52
54 0.58
55 0.58
56 0.64
57 0.63
58 0.57
59 0.55
60 0.52
61 0.46
62 0.41
63 0.4
64 0.36
65 0.39
66 0.39
67 0.37
68 0.35
69 0.36
70 0.41
71 0.39