Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A0HW25

Protein Details
Accession A0A0A0HW25   
Localization Confidence Low
Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
63-83GENLGKKTRPFRRNRLNTASSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 11.666, nucl 11.5, mito 11.5, cyto_nucl 7.833, cyto_mito 7.833
Family & Domain DBs
KEGG pbn:PADG_11205  -  
Amino Acid Sequences MERRQHRTRQVGRGGIPKSGFGNLESLVAATVCLAELRYEDNRSNPIIITQPYGGQRSIASMGENLGKKTRPFRRNRLNTASSHPQKSISPQSMFP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.58
3 0.5
4 0.41
5 0.34
6 0.3
7 0.26
8 0.18
9 0.19
10 0.14
11 0.14
12 0.12
13 0.11
14 0.09
15 0.08
16 0.07
17 0.04
18 0.04
19 0.03
20 0.03
21 0.03
22 0.03
23 0.04
24 0.07
25 0.1
26 0.13
27 0.13
28 0.15
29 0.17
30 0.18
31 0.18
32 0.14
33 0.13
34 0.13
35 0.13
36 0.13
37 0.11
38 0.13
39 0.15
40 0.16
41 0.15
42 0.13
43 0.12
44 0.12
45 0.14
46 0.11
47 0.1
48 0.08
49 0.1
50 0.14
51 0.15
52 0.14
53 0.16
54 0.17
55 0.19
56 0.28
57 0.38
58 0.43
59 0.51
60 0.6
61 0.69
62 0.77
63 0.84
64 0.84
65 0.78
66 0.72
67 0.72
68 0.72
69 0.68
70 0.61
71 0.53
72 0.47
73 0.44
74 0.48
75 0.5
76 0.47