FuNGI

A0A168SXS5

Protein Details

Accession

A0A168SXS5

Localization Confidence

Medium

Confidence Score

10.6

NoLS Segment(s)

Position	Sequence	Protein Nature
144-169	APMPSGKKKSRGKGKKSKGNPSAPKA	Basic

NLS Segment(s)

Position	Sequence
146-190	MPSGKKKSRGKGKKSKGNPSAPKALKVPKANYPPPPPSGPRLKAP

Subcellular Location(s)

cyto_nucl 10, nucl 9, cyto 9, mito 6

Family & Domain DBs

Amino Acid Sequences

MYQNALANGSWGAPIPENPSYQQRSGSEQESQGDDGSSGSDYDEFDSDEDEEDEEYAPLQMGAWGTQPTGSEADANAIQMPDWNARPTDTTPSLTFKADDWKKLCDPNVVIKAGIGSGNLHRKGANYIPVTEQQILNQRLKLGAPMPSGKKKSRGKGKKSKGNPSAPKALKVPKANYPPPPPSGPRLKAPSRPVPTNSAWGQQLSSTPFWEQGGAKSSKYAPATPPPAQQPQQPKPQQPQQPQQQQRVPPARSAPPQSPASKWATQPLQETFTPPPPQQKQPQQAPPQQAPPPTKVFGSSQSKYATAQPIPPTQPARPTQPTQPTQPTQPAQPQPTQPAQPAAPVTPSYHGTISLTDQSPPTPPPRTTIFQLNIELIPGVTALLPVYETDDYTVLVKEFGAKHHLTIAPQAEFSFAEKIKQMVAGLRKQQQEAQ

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.13
2	0.18
3	0.22
4	0.23
5	0.26
6	0.34
7	0.38
8	0.39
9	0.43
10	0.39
11	0.42
12	0.45
13	0.45
14	0.42
15	0.39
16	0.4
17	0.37
18	0.36
19	0.29
20	0.25
21	0.21
22	0.16
23	0.14
24	0.12
25	0.09
26	0.08
27	0.09
28	0.09
29	0.11
30	0.11
31	0.11
32	0.11
33	0.12
34	0.12
35	0.12
36	0.12
37	0.11
38	0.1
39	0.11
40	0.11
41	0.09
42	0.09
43	0.08
44	0.07
45	0.06
46	0.06
47	0.07
48	0.07
49	0.08
50	0.09
51	0.1
52	0.1
53	0.11
54	0.11
55	0.12
56	0.13
57	0.13
58	0.12
59	0.11
60	0.14
61	0.13
62	0.13
63	0.12
64	0.11
65	0.1
66	0.11
67	0.14
68	0.14
69	0.16
70	0.17
71	0.17
72	0.18
73	0.21
74	0.22
75	0.27
76	0.26
77	0.28
78	0.29
79	0.33
80	0.34
81	0.32
82	0.3
83	0.23
84	0.31
85	0.31
86	0.36
87	0.34
88	0.38
89	0.41
90	0.45
91	0.46
92	0.41
93	0.41
94	0.42
95	0.46
96	0.41
97	0.37
98	0.32
99	0.3
100	0.24
101	0.22
102	0.13
103	0.08
104	0.13
105	0.21
106	0.21
107	0.21
108	0.21
109	0.22
110	0.26
111	0.27
112	0.3
113	0.24
114	0.25
115	0.27
116	0.3
117	0.32
118	0.3
119	0.27
120	0.22
121	0.29
122	0.31
123	0.3
124	0.28
125	0.25
126	0.24
127	0.24
128	0.23
129	0.17
130	0.17
131	0.18
132	0.22
133	0.27
134	0.34
135	0.39
136	0.4
137	0.48
138	0.51
139	0.57
140	0.63
141	0.68
142	0.71
143	0.77
144	0.85
145	0.85
146	0.86
147	0.88
148	0.86
149	0.85
150	0.82
151	0.77
152	0.77
153	0.68
154	0.62
155	0.56
156	0.54
157	0.5
158	0.48
159	0.45
160	0.43
161	0.5
162	0.52
163	0.54
164	0.54
165	0.51
166	0.49
167	0.5
168	0.45
169	0.42
170	0.46
171	0.42
172	0.41
173	0.44
174	0.45
175	0.48
176	0.52
177	0.56
178	0.51
179	0.52
180	0.49
181	0.48
182	0.45
183	0.44
184	0.39
185	0.32
186	0.28
187	0.24
188	0.22
189	0.17
190	0.17
191	0.15
192	0.14
193	0.12
194	0.12
195	0.12
196	0.12
197	0.13
198	0.12
199	0.1
200	0.16
201	0.16
202	0.16
203	0.17
204	0.17
205	0.2
206	0.2
207	0.2
208	0.17
209	0.22
210	0.28
211	0.28
212	0.31
213	0.31
214	0.35
215	0.35
216	0.37
217	0.41
218	0.41
219	0.49
220	0.51
221	0.52
222	0.53
223	0.6
224	0.64
225	0.62
226	0.66
227	0.65
228	0.71
229	0.72
230	0.73
231	0.71
232	0.66
233	0.67
234	0.67
235	0.58
236	0.5
237	0.48
238	0.45
239	0.44
240	0.44
241	0.37
242	0.34
243	0.37
244	0.36
245	0.33
246	0.33
247	0.34
248	0.33
249	0.32
250	0.32
251	0.31
252	0.31
253	0.33
254	0.31
255	0.29
256	0.26
257	0.28
258	0.25
259	0.29
260	0.3
261	0.28
262	0.35
263	0.36
264	0.42
265	0.47
266	0.54
267	0.57
268	0.62
269	0.7
270	0.7
271	0.71
272	0.72
273	0.66
274	0.64
275	0.58
276	0.56
277	0.5
278	0.45
279	0.43
280	0.38
281	0.35
282	0.3
283	0.29
284	0.31
285	0.36
286	0.32
287	0.32
288	0.33
289	0.33
290	0.32
291	0.35
292	0.32
293	0.25
294	0.29
295	0.29
296	0.34
297	0.36
298	0.39
299	0.39
300	0.35
301	0.4
302	0.38
303	0.42
304	0.42
305	0.43
306	0.47
307	0.52
308	0.54
309	0.54
310	0.59
311	0.53
312	0.52
313	0.57
314	0.5
315	0.46
316	0.51
317	0.51
318	0.48
319	0.5
320	0.49
321	0.48
322	0.51
323	0.49
324	0.42
325	0.39
326	0.35
327	0.33
328	0.31
329	0.26
330	0.23
331	0.21
332	0.21
333	0.2
334	0.21
335	0.2
336	0.19
337	0.18
338	0.17
339	0.17
340	0.18
341	0.21
342	0.2
343	0.19
344	0.19
345	0.2
346	0.22
347	0.23
348	0.26
349	0.27
350	0.26
351	0.29
352	0.35
353	0.39
354	0.4
355	0.46
356	0.45
357	0.43
358	0.44
359	0.42
360	0.36
361	0.32
362	0.28
363	0.18
364	0.14
365	0.09
366	0.08
367	0.05
368	0.05
369	0.04
370	0.04
371	0.05
372	0.05
373	0.09
374	0.09
375	0.09
376	0.11
377	0.11
378	0.12
379	0.13
380	0.14
381	0.1
382	0.1
383	0.1
384	0.14
385	0.15
386	0.17
387	0.23
388	0.22
389	0.23
390	0.29
391	0.32
392	0.27
393	0.32
394	0.35
395	0.3
396	0.3
397	0.29
398	0.24
399	0.23
400	0.24
401	0.24
402	0.19
403	0.2
404	0.21
405	0.22
406	0.22
407	0.23
408	0.22
409	0.22
410	0.29
411	0.34
412	0.41
413	0.48
414	0.51

A0A168SXS5

3D AlphaFold-predicted Structure Viewer