Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168MJ70

Protein Details
Accession A0A168MJ70    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-39MCDIKQWLGRRHHRRLRYRRRLRRSKSKVERKMKNDYFIBasic
NLS Segment(s)
PositionSequence
9-33GRRHHRRLRYRRRLRRSKSKVERKM
Subcellular Location(s) nucl 20, mito_nucl 13.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003213  Cyt_c_oxidase_su6B  
IPR036549  Cyt_c_oxidase_su6B_sf  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0045277  C:respiratory chain complex IV  
Pfam View protein in Pfam  
PF02297  COX6B  
PROSITE View protein in PROSITE  
PS51808  CHCH  
CDD cd00926  Cyt_c_Oxidase_VIb  
Amino Acid Sequences MCDIKQWLGRRHHRRLRYRRRLRRSKSKVERKMKNDYFITNALSTIEFHSVDLQTGNTDVSMAMTKCDTLTACCWQNYVDYFKCIDARGEDFVPCKQFWRNYHSLCPNSWVEKWDTQREAGENPSNFSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.89
3 0.91
4 0.91
5 0.93
6 0.93
7 0.95
8 0.96
9 0.94
10 0.95
11 0.93
12 0.93
13 0.92
14 0.93
15 0.92
16 0.91
17 0.91
18 0.86
19 0.87
20 0.8
21 0.76
22 0.68
23 0.59
24 0.52
25 0.44
26 0.41
27 0.3
28 0.25
29 0.19
30 0.16
31 0.15
32 0.12
33 0.12
34 0.1
35 0.1
36 0.11
37 0.11
38 0.1
39 0.1
40 0.09
41 0.07
42 0.07
43 0.07
44 0.05
45 0.05
46 0.04
47 0.04
48 0.06
49 0.06
50 0.06
51 0.06
52 0.06
53 0.06
54 0.07
55 0.06
56 0.06
57 0.09
58 0.13
59 0.15
60 0.15
61 0.16
62 0.15
63 0.17
64 0.18
65 0.21
66 0.18
67 0.17
68 0.18
69 0.19
70 0.2
71 0.19
72 0.18
73 0.14
74 0.16
75 0.17
76 0.17
77 0.17
78 0.17
79 0.2
80 0.22
81 0.19
82 0.2
83 0.22
84 0.28
85 0.31
86 0.38
87 0.44
88 0.45
89 0.54
90 0.6
91 0.58
92 0.52
93 0.53
94 0.48
95 0.44
96 0.41
97 0.35
98 0.32
99 0.37
100 0.42
101 0.45
102 0.44
103 0.42
104 0.44
105 0.43
106 0.41
107 0.4
108 0.42
109 0.35