Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A163JR74

Protein Details
Accession A0A163JR74   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
39-73QWASRLRRLRLRYRRRQRRGRSKSRKEKVGHDKLKBasic
NLS Segment(s)
PositionSequence
43-81RLRRLRLRYRRRQRRGRSKSRKEKVGHDKLKGWQGAERR
Subcellular Location(s) mito 16.5, cyto_mito 12, cyto 6.5, nucl 4
Family & Domain DBs
Amino Acid Sequences MAMESTMDEVSARKKKFKGFPLLVIFKNFETALFCDIKQWASRLRRLRLRYRRRQRRGRSKSRKEKVGHDKLKGWQGAERRGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.44
3 0.52
4 0.6
5 0.62
6 0.58
7 0.64
8 0.66
9 0.68
10 0.61
11 0.55
12 0.47
13 0.36
14 0.34
15 0.25
16 0.17
17 0.14
18 0.13
19 0.14
20 0.14
21 0.14
22 0.13
23 0.14
24 0.15
25 0.13
26 0.14
27 0.18
28 0.2
29 0.27
30 0.33
31 0.39
32 0.45
33 0.5
34 0.6
35 0.64
36 0.71
37 0.75
38 0.8
39 0.85
40 0.87
41 0.92
42 0.93
43 0.93
44 0.94
45 0.94
46 0.94
47 0.94
48 0.95
49 0.93
50 0.91
51 0.84
52 0.83
53 0.83
54 0.83
55 0.79
56 0.73
57 0.7
58 0.67
59 0.71
60 0.62
61 0.53
62 0.47
63 0.46