Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A163JSQ4

Protein Details
Accession A0A163JSQ4    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
34-70SCDIKQWASRHRRHRLRYRRRRRRSRSKKSKTKRWSCBasic
NLS Segment(s)
PositionSequence
42-67SRHRRHRLRYRRRRRRSRSKKSKTKR
Subcellular Location(s) mito 14.5, mito_nucl 12.666, nucl 9.5, cyto_nucl 6.833
Family & Domain DBs
Amino Acid Sequences MAMESTMDEVSARKKKFKGFPLFFMSKNFKTALSCDIKQWASRHRRHRLRYRRRRRRSRSKKSKTKRWSC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.43
3 0.52
4 0.6
5 0.63
6 0.6
7 0.64
8 0.66
9 0.65
10 0.58
11 0.55
12 0.52
13 0.41
14 0.39
15 0.33
16 0.25
17 0.23
18 0.23
19 0.24
20 0.23
21 0.23
22 0.21
23 0.25
24 0.25
25 0.27
26 0.28
27 0.31
28 0.35
29 0.42
30 0.51
31 0.58
32 0.67
33 0.73
34 0.82
35 0.84
36 0.86
37 0.9
38 0.91
39 0.92
40 0.94
41 0.96
42 0.96
43 0.96
44 0.96
45 0.96
46 0.96
47 0.96
48 0.97
49 0.96
50 0.97