Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A163IX00

Protein Details
Accession A0A163IX00   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-35ADMKLWSSRHYRHHRRRHRRYRRSRSEVEKKRVVBasic
NLS Segment(s)
PositionSequence
13-33RHHRRRHRRYRRSRSEVEKKR
Subcellular Location(s) nucl 9, mito 7, cyto_nucl 7, cyto 5, plas 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MADMKLWSSRHYRHHRRRHRRYRRSRSEVEKKRVVMQKVNVIHGKEKDGQDTEKGESYRSFVIVVVVGVVFIVVVVVVERC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.85
3 0.89
4 0.95
5 0.96
6 0.96
7 0.96
8 0.97
9 0.97
10 0.97
11 0.94
12 0.91
13 0.9
14 0.9
15 0.89
16 0.85
17 0.8
18 0.7
19 0.69
20 0.66
21 0.58
22 0.53
23 0.46
24 0.45
25 0.41
26 0.44
27 0.38
28 0.33
29 0.33
30 0.28
31 0.29
32 0.25
33 0.24
34 0.23
35 0.23
36 0.23
37 0.23
38 0.25
39 0.23
40 0.23
41 0.22
42 0.21
43 0.19
44 0.21
45 0.19
46 0.17
47 0.16
48 0.11
49 0.12
50 0.11
51 0.1
52 0.08
53 0.07
54 0.06
55 0.05
56 0.05
57 0.03
58 0.03
59 0.03
60 0.02
61 0.02