Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A168LEW3

Protein Details
Accession A0A168LEW3    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
19-42AHPGSKQTAKKRKLQAKKYMNDEAHydrophilic
NLS Segment(s)
PositionSequence
27-36AKKRKLQAKK
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF00170  bZIP_1  
PROSITE View protein in PROSITE  
PS50217  BZIP  
CDD cd14687  bZIP_ATF2  
Amino Acid Sequences MSNDVSTSIDPFNIVSNPAHPGSKQTAKKRKLQAKKYMNDEAKRKNFLERNRQAALKCRQRKKQWLNDLQSKVDYLTNDNEQLQLQCSLMRDELIQLRRMLWTHKEVHSISTVALITSFNP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.12
3 0.13
4 0.17
5 0.18
6 0.19
7 0.16
8 0.2
9 0.25
10 0.34
11 0.41
12 0.48
13 0.56
14 0.6
15 0.69
16 0.74
17 0.77
18 0.79
19 0.8
20 0.8
21 0.8
22 0.82
23 0.8
24 0.79
25 0.76
26 0.72
27 0.7
28 0.69
29 0.64
30 0.62
31 0.56
32 0.54
33 0.53
34 0.55
35 0.59
36 0.54
37 0.54
38 0.52
39 0.54
40 0.47
41 0.5
42 0.51
43 0.5
44 0.53
45 0.55
46 0.61
47 0.66
48 0.76
49 0.77
50 0.78
51 0.78
52 0.79
53 0.78
54 0.78
55 0.74
56 0.64
57 0.55
58 0.45
59 0.36
60 0.28
61 0.21
62 0.15
63 0.15
64 0.16
65 0.17
66 0.16
67 0.16
68 0.15
69 0.15
70 0.14
71 0.12
72 0.1
73 0.1
74 0.11
75 0.12
76 0.12
77 0.12
78 0.1
79 0.12
80 0.19
81 0.2
82 0.22
83 0.21
84 0.22
85 0.23
86 0.24
87 0.25
88 0.23
89 0.27
90 0.3
91 0.32
92 0.38
93 0.36
94 0.38
95 0.37
96 0.33
97 0.26
98 0.24
99 0.21
100 0.15
101 0.15