Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A163K369

Protein Details
Accession A0A163K369    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
117-143DNDTIKTSKNIHRKGKRRAAKAAACCGHydrophilic
NLS Segment(s)
PositionSequence
127-137IHRKGKRRAAK
Subcellular Location(s) mito 12, nucl 10, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR045298  Complex1_LYR_LYRM7  
Gene Ontology GO:0005759  C:mitochondrial matrix  
GO:0034551  P:mitochondrial respiratory chain complex III assembly  
CDD cd20267  Complex1_LYR_LYRM7  
Amino Acid Sequences MMSTPSKQAAISAYRNLLRTQKEVFGNDLRAIQAAKKETYARFMQFKDETNTDVLDEKLTLAKQVASLLRQNVVQGESKDGEHFSKSRTEGKDSFSHDTTLSFPLELNITKDTELGDNDTIKTSKNIHRKGKRRAAKAAACCGGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.35
3 0.37
4 0.38
5 0.35
6 0.35
7 0.34
8 0.35
9 0.37
10 0.37
11 0.39
12 0.37
13 0.36
14 0.34
15 0.31
16 0.25
17 0.22
18 0.21
19 0.17
20 0.18
21 0.18
22 0.18
23 0.19
24 0.23
25 0.23
26 0.28
27 0.3
28 0.29
29 0.3
30 0.3
31 0.34
32 0.32
33 0.34
34 0.33
35 0.31
36 0.28
37 0.25
38 0.24
39 0.19
40 0.18
41 0.15
42 0.1
43 0.09
44 0.08
45 0.09
46 0.08
47 0.08
48 0.07
49 0.07
50 0.07
51 0.1
52 0.1
53 0.1
54 0.12
55 0.12
56 0.13
57 0.13
58 0.12
59 0.11
60 0.11
61 0.12
62 0.1
63 0.12
64 0.12
65 0.12
66 0.13
67 0.13
68 0.12
69 0.12
70 0.12
71 0.11
72 0.15
73 0.17
74 0.24
75 0.25
76 0.3
77 0.3
78 0.34
79 0.38
80 0.38
81 0.41
82 0.35
83 0.34
84 0.28
85 0.27
86 0.25
87 0.21
88 0.17
89 0.12
90 0.11
91 0.11
92 0.12
93 0.12
94 0.12
95 0.12
96 0.12
97 0.12
98 0.13
99 0.13
100 0.13
101 0.13
102 0.14
103 0.15
104 0.15
105 0.16
106 0.18
107 0.18
108 0.17
109 0.19
110 0.22
111 0.28
112 0.37
113 0.46
114 0.54
115 0.65
116 0.73
117 0.82
118 0.87
119 0.88
120 0.85
121 0.85
122 0.85
123 0.83
124 0.81
125 0.79