Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A163JAR1

Protein Details
Accession A0A163JAR1    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
59-83LVLGSRGRRRNHRRRLREHMGRISNBasic
NLS Segment(s)
PositionSequence
64-75RGRRRNHRRRLR
Subcellular Location(s) nucl 20, mito 4, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001623  DnaJ_domain  
IPR036869  J_dom_sf  
Pfam View protein in Pfam  
PF00226  DnaJ  
PROSITE View protein in PROSITE  
PS50076  DNAJ_2  
CDD cd06257  DnaJ  
Amino Acid Sequences MPNYFALLDLPLIVSRDRIKQGYLSLALASHPDLLDLRPNPANQEEKSRHFCRLAQAYLVLGSRGRRRNHRRRLREHMGRISNDFEPIETLERAYEVFDDVMDDLYCLLIKGKIKPNVARR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.14
3 0.19
4 0.23
5 0.23
6 0.24
7 0.25
8 0.27
9 0.29
10 0.28
11 0.23
12 0.19
13 0.18
14 0.17
15 0.15
16 0.14
17 0.09
18 0.08
19 0.08
20 0.08
21 0.08
22 0.14
23 0.14
24 0.17
25 0.19
26 0.19
27 0.21
28 0.24
29 0.28
30 0.23
31 0.31
32 0.32
33 0.36
34 0.43
35 0.43
36 0.42
37 0.39
38 0.4
39 0.37
40 0.38
41 0.33
42 0.26
43 0.25
44 0.22
45 0.21
46 0.19
47 0.13
48 0.08
49 0.09
50 0.15
51 0.22
52 0.25
53 0.34
54 0.45
55 0.56
56 0.66
57 0.74
58 0.78
59 0.8
60 0.87
61 0.87
62 0.86
63 0.83
64 0.81
65 0.77
66 0.68
67 0.61
68 0.55
69 0.45
70 0.37
71 0.29
72 0.2
73 0.15
74 0.15
75 0.15
76 0.12
77 0.12
78 0.1
79 0.11
80 0.11
81 0.1
82 0.09
83 0.07
84 0.07
85 0.07
86 0.08
87 0.08
88 0.09
89 0.08
90 0.08
91 0.06
92 0.07
93 0.07
94 0.06
95 0.07
96 0.09
97 0.12
98 0.2
99 0.3
100 0.37
101 0.44