Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A168LHX2

Protein Details
Accession A0A168LHX2    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
9-37KPSSSSGGKKAKKKWSAKKVKDKANNMVVHydrophilic
NLS Segment(s)
PositionSequence
11-31SSSSGGKKAKKKWSAKKVKDK
Subcellular Location(s) nucl 20, cyto_nucl 12.666, mito_nucl 12.666, mito 3, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAKKDVAAKPSSSSGGKKAKKKWSAKKVKDKANNMVVLDKPTYERLFKEVPTYKLISQSVLVDRLKLNGSLARVALKELTAQGLIKPLTIHHAQVIYTRVGSDEKASGKQADAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.42
3 0.47
4 0.52
5 0.58
6 0.65
7 0.72
8 0.8
9 0.82
10 0.83
11 0.87
12 0.89
13 0.92
14 0.9
15 0.91
16 0.89
17 0.85
18 0.82
19 0.78
20 0.71
21 0.6
22 0.55
23 0.45
24 0.38
25 0.32
26 0.24
27 0.18
28 0.18
29 0.19
30 0.17
31 0.16
32 0.18
33 0.19
34 0.19
35 0.26
36 0.28
37 0.28
38 0.3
39 0.32
40 0.28
41 0.31
42 0.31
43 0.23
44 0.18
45 0.18
46 0.16
47 0.18
48 0.17
49 0.13
50 0.13
51 0.14
52 0.14
53 0.13
54 0.12
55 0.1
56 0.11
57 0.11
58 0.12
59 0.12
60 0.11
61 0.11
62 0.11
63 0.09
64 0.09
65 0.08
66 0.09
67 0.08
68 0.08
69 0.08
70 0.12
71 0.12
72 0.12
73 0.12
74 0.11
75 0.15
76 0.16
77 0.16
78 0.14
79 0.16
80 0.16
81 0.19
82 0.21
83 0.17
84 0.16
85 0.15
86 0.15
87 0.15
88 0.15
89 0.15
90 0.17
91 0.19
92 0.22
93 0.24
94 0.24