Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A168NGY7

Protein Details
Accession A0A168NGY7    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
83-105HASLPTRQRQHKRQHPEVTHPTCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 11, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR026960  RVT-Znf  
Pfam View protein in Pfam  
PF13966  zf-RVT  
Amino Acid Sequences MPPATSTLDWTLQVSKNTATKIMDLSPGSFRKTLHPDHHLTLAPLHPPHWIPMGMRLPRPVWQSFWRLPIAHKTTTVWWRLLHASLPTRQRQHKRQHPEVTHPTCLLCNTATLGPAPPSLHPKSLFGCTVHHEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.26
3 0.28
4 0.28
5 0.29
6 0.25
7 0.23
8 0.24
9 0.23
10 0.24
11 0.22
12 0.23
13 0.26
14 0.27
15 0.28
16 0.27
17 0.26
18 0.29
19 0.34
20 0.39
21 0.39
22 0.43
23 0.44
24 0.44
25 0.48
26 0.41
27 0.36
28 0.31
29 0.26
30 0.23
31 0.19
32 0.18
33 0.15
34 0.15
35 0.16
36 0.16
37 0.15
38 0.12
39 0.19
40 0.27
41 0.27
42 0.28
43 0.28
44 0.27
45 0.3
46 0.33
47 0.27
48 0.23
49 0.24
50 0.29
51 0.29
52 0.32
53 0.3
54 0.26
55 0.26
56 0.31
57 0.32
58 0.27
59 0.25
60 0.23
61 0.26
62 0.31
63 0.32
64 0.25
65 0.21
66 0.22
67 0.23
68 0.22
69 0.19
70 0.18
71 0.19
72 0.22
73 0.28
74 0.31
75 0.36
76 0.44
77 0.51
78 0.57
79 0.64
80 0.69
81 0.73
82 0.78
83 0.82
84 0.79
85 0.8
86 0.81
87 0.76
88 0.69
89 0.6
90 0.51
91 0.42
92 0.37
93 0.29
94 0.19
95 0.14
96 0.13
97 0.13
98 0.13
99 0.13
100 0.14
101 0.14
102 0.16
103 0.16
104 0.16
105 0.23
106 0.26
107 0.3
108 0.3
109 0.32
110 0.33
111 0.37
112 0.37
113 0.31
114 0.31