Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A163KNE9

Protein Details
Accession A0A163KNE9   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
3-36DIELWPSRHLRHRYRRYRRYRRQRPSRSDFENKEBasic
NLS Segment(s)
PositionSequence
13-27RHRYRRYRRYRRQRP
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MGDIELWPSRHLRHRYRRYRRYRRQRPSRSDFENKEERCKRQNVGQITVVVVYRRRRRRVIIVSMENKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.74
3 0.83
4 0.89
5 0.91
6 0.94
7 0.95
8 0.95
9 0.95
10 0.95
11 0.95
12 0.95
13 0.94
14 0.91
15 0.87
16 0.83
17 0.81
18 0.73
19 0.68
20 0.67
21 0.58
22 0.6
23 0.57
24 0.53
25 0.49
26 0.49
27 0.45
28 0.43
29 0.5
30 0.45
31 0.44
32 0.43
33 0.38
34 0.34
35 0.33
36 0.27
37 0.21
38 0.21
39 0.25
40 0.32
41 0.4
42 0.47
43 0.51
44 0.57
45 0.66
46 0.71
47 0.73
48 0.74
49 0.75