Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A163KRY7

Protein Details
Accession A0A163KRY7    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
11-36ICLVPTKTINQRKKHAKCRDARLDQPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito 12, mito_nucl 12
Family & Domain DBs
Amino Acid Sequences MGKFSSTICPICLVPTKTINQRKKHAKCRDARLDQPGPSESSSQQSVITTEPLVTMAIDMEDDLVDFDFDDGATTASLNTHFTLSERNVQQEWL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.31
3 0.36
4 0.43
5 0.53
6 0.58
7 0.58
8 0.65
9 0.72
10 0.77
11 0.82
12 0.83
13 0.82
14 0.82
15 0.85
16 0.86
17 0.82
18 0.77
19 0.75
20 0.69
21 0.61
22 0.55
23 0.46
24 0.37
25 0.31
26 0.28
27 0.2
28 0.18
29 0.17
30 0.15
31 0.14
32 0.12
33 0.12
34 0.11
35 0.11
36 0.08
37 0.07
38 0.07
39 0.07
40 0.06
41 0.05
42 0.05
43 0.04
44 0.04
45 0.04
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.04
54 0.04
55 0.04
56 0.04
57 0.04
58 0.04
59 0.05
60 0.05
61 0.05
62 0.05
63 0.06
64 0.07
65 0.08
66 0.08
67 0.09
68 0.09
69 0.1
70 0.16
71 0.18
72 0.26
73 0.27
74 0.31