Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168Q0K9

Protein Details
Accession A0A168Q0K9   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
63-90CSDTDKDKTYERRRYQQQTKEKQQPQVFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR018940  EF-1_beta_acid_region_euk  
IPR001326  Transl_elong_EF1B_B/D_CS  
Gene Ontology GO:0005853  C:eukaryotic translation elongation factor 1 complex  
GO:0003746  F:translation elongation factor activity  
Pfam View protein in Pfam  
PF10587  EF-1_beta_acid  
PROSITE View protein in PROSITE  
PS00824  EF1BD_1  
Amino Acid Sequences MVLSAFKSKRNTCKKATPAIDTQHESQMKHSKLANFMNKLSDPRPLRHVLKRPSMAHLTSYFCSDTDKDKTYERRRYQQQTKEKQQPQVFQNEQPLSVNKKVPSILVRRPSLPCLDDGFSSRYLSNPSFIGGDPNRHKTGTDDSSICYDTKKMMMDQDKRSAYSTLFSLSTTNTGSTTFTQPQIWDSAFWFDHPPLTRKVSAPPERHPDVPAILHELRRINTISTHPLVLKRGRFEVSIETAAAAAAAPAAAAEEDEDDIDLFGSDDDEVDEEAEKVKAARIAEYNAKKANKPKPTAKTTVTLEVKPWDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.79
3 0.78
4 0.74
5 0.71
6 0.7
7 0.69
8 0.63
9 0.58
10 0.56
11 0.54
12 0.47
13 0.47
14 0.49
15 0.43
16 0.43
17 0.45
18 0.4
19 0.45
20 0.54
21 0.55
22 0.5
23 0.5
24 0.52
25 0.49
26 0.49
27 0.43
28 0.43
29 0.38
30 0.37
31 0.41
32 0.43
33 0.48
34 0.52
35 0.61
36 0.6
37 0.66
38 0.71
39 0.66
40 0.66
41 0.64
42 0.56
43 0.5
44 0.45
45 0.4
46 0.33
47 0.33
48 0.27
49 0.22
50 0.24
51 0.21
52 0.23
53 0.25
54 0.28
55 0.27
56 0.33
57 0.44
58 0.51
59 0.6
60 0.62
61 0.66
62 0.72
63 0.81
64 0.83
65 0.83
66 0.84
67 0.84
68 0.87
69 0.88
70 0.84
71 0.82
72 0.78
73 0.76
74 0.68
75 0.68
76 0.61
77 0.53
78 0.56
79 0.48
80 0.42
81 0.37
82 0.36
83 0.32
84 0.33
85 0.34
86 0.26
87 0.28
88 0.28
89 0.28
90 0.31
91 0.32
92 0.35
93 0.38
94 0.39
95 0.4
96 0.41
97 0.41
98 0.38
99 0.32
100 0.27
101 0.23
102 0.22
103 0.2
104 0.2
105 0.21
106 0.18
107 0.19
108 0.17
109 0.14
110 0.17
111 0.16
112 0.15
113 0.13
114 0.12
115 0.12
116 0.12
117 0.17
118 0.15
119 0.22
120 0.24
121 0.29
122 0.3
123 0.29
124 0.29
125 0.25
126 0.31
127 0.27
128 0.26
129 0.22
130 0.21
131 0.23
132 0.24
133 0.22
134 0.15
135 0.12
136 0.1
137 0.11
138 0.11
139 0.1
140 0.14
141 0.22
142 0.29
143 0.32
144 0.39
145 0.37
146 0.37
147 0.38
148 0.34
149 0.26
150 0.2
151 0.17
152 0.11
153 0.11
154 0.1
155 0.09
156 0.09
157 0.1
158 0.09
159 0.09
160 0.08
161 0.08
162 0.09
163 0.11
164 0.15
165 0.15
166 0.16
167 0.16
168 0.16
169 0.17
170 0.18
171 0.16
172 0.12
173 0.12
174 0.14
175 0.13
176 0.14
177 0.15
178 0.12
179 0.16
180 0.18
181 0.2
182 0.2
183 0.24
184 0.25
185 0.24
186 0.31
187 0.37
188 0.44
189 0.46
190 0.48
191 0.52
192 0.53
193 0.53
194 0.47
195 0.39
196 0.32
197 0.29
198 0.23
199 0.22
200 0.21
201 0.21
202 0.23
203 0.24
204 0.22
205 0.23
206 0.24
207 0.18
208 0.19
209 0.21
210 0.23
211 0.22
212 0.23
213 0.22
214 0.24
215 0.28
216 0.3
217 0.31
218 0.29
219 0.31
220 0.31
221 0.3
222 0.29
223 0.3
224 0.28
225 0.26
226 0.23
227 0.2
228 0.18
229 0.17
230 0.15
231 0.09
232 0.05
233 0.03
234 0.03
235 0.02
236 0.02
237 0.03
238 0.02
239 0.03
240 0.03
241 0.04
242 0.05
243 0.05
244 0.05
245 0.05
246 0.05
247 0.06
248 0.05
249 0.05
250 0.04
251 0.05
252 0.05
253 0.05
254 0.05
255 0.06
256 0.06
257 0.06
258 0.07
259 0.07
260 0.08
261 0.08
262 0.08
263 0.08
264 0.1
265 0.13
266 0.13
267 0.17
268 0.18
269 0.24
270 0.33
271 0.38
272 0.42
273 0.46
274 0.49
275 0.5
276 0.56
277 0.61
278 0.61
279 0.64
280 0.68
281 0.71
282 0.76
283 0.79
284 0.73
285 0.71
286 0.66
287 0.68
288 0.63
289 0.55
290 0.49