Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A163KNA0

Protein Details
Accession A0A163KNA0   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
12-53LICDIKQWSSRHRRRRHRYHRRHRYHRRHRRSESKDEKKSKDBasic
NLS Segment(s)
PositionSequence
22-52RHRRRRHRYHRRHRYHRRHRRSESKDEKKSK
Subcellular Location(s) mito 14.5, mito_nucl 13.333, nucl 11, cyto_nucl 6.333
Family & Domain DBs
Amino Acid Sequences MFSLWKNFKAALICDIKQWSSRHRRRRHRYHRRHRYHRRHRRSESKDEKKSKDVKGNWLVVVSKRMLRWDSYRLFVVVCLSSFVVARRSSCEANAGGKNKSDKEAKKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.34
3 0.32
4 0.34
5 0.35
6 0.37
7 0.43
8 0.52
9 0.59
10 0.67
11 0.77
12 0.82
13 0.91
14 0.93
15 0.93
16 0.95
17 0.96
18 0.97
19 0.96
20 0.97
21 0.97
22 0.97
23 0.96
24 0.96
25 0.96
26 0.95
27 0.93
28 0.93
29 0.9
30 0.89
31 0.89
32 0.88
33 0.87
34 0.84
35 0.79
36 0.76
37 0.75
38 0.69
39 0.67
40 0.59
41 0.57
42 0.55
43 0.54
44 0.46
45 0.4
46 0.36
47 0.27
48 0.27
49 0.2
50 0.16
51 0.14
52 0.17
53 0.16
54 0.18
55 0.21
56 0.26
57 0.27
58 0.27
59 0.28
60 0.26
61 0.24
62 0.22
63 0.2
64 0.14
65 0.11
66 0.1
67 0.09
68 0.09
69 0.1
70 0.11
71 0.13
72 0.13
73 0.14
74 0.17
75 0.22
76 0.23
77 0.23
78 0.25
79 0.23
80 0.28
81 0.34
82 0.34
83 0.31
84 0.35
85 0.39
86 0.38
87 0.41
88 0.45