Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168MEG9

Protein Details
Accession A0A168MEG9   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
91-110GVGKKPKDSGRKKCTNCGVTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 13.833, cyto 6, cyto_mito 5.165
Family & Domain DBs
InterPro View protein in InterPro  
IPR000679  Znf_GATA  
IPR013088  Znf_NHR/GATA  
Gene Ontology GO:0043565  F:sequence-specific DNA binding  
GO:0008270  F:zinc ion binding  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF00320  GATA  
PROSITE View protein in PROSITE  
PS00344  GATA_ZN_FINGER_1  
PS50114  GATA_ZN_FINGER_2  
CDD cd00202  ZnF_GATA  
Amino Acid Sequences MNHYIDMLTGQGLLYDEFGDTYCFDQANQSLMMGAHPNGAIYQDLVYFNRFCFPSSSPLSSDSSTFMDNSHTVSSASVDPSPELKLNSATGVGKKPKDSGRKKCTNCGVTKTPSWRRSVEGSRLLCNACGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.06
4 0.07
5 0.07
6 0.08
7 0.08
8 0.09
9 0.1
10 0.09
11 0.09
12 0.12
13 0.13
14 0.14
15 0.14
16 0.12
17 0.12
18 0.12
19 0.12
20 0.11
21 0.1
22 0.09
23 0.08
24 0.08
25 0.07
26 0.08
27 0.07
28 0.06
29 0.07
30 0.07
31 0.08
32 0.09
33 0.11
34 0.1
35 0.1
36 0.13
37 0.13
38 0.13
39 0.15
40 0.16
41 0.2
42 0.23
43 0.25
44 0.23
45 0.25
46 0.27
47 0.24
48 0.23
49 0.18
50 0.16
51 0.14
52 0.13
53 0.11
54 0.1
55 0.1
56 0.11
57 0.09
58 0.09
59 0.08
60 0.08
61 0.1
62 0.09
63 0.1
64 0.09
65 0.09
66 0.09
67 0.1
68 0.12
69 0.11
70 0.11
71 0.11
72 0.12
73 0.12
74 0.12
75 0.13
76 0.12
77 0.13
78 0.19
79 0.24
80 0.24
81 0.25
82 0.3
83 0.36
84 0.46
85 0.54
86 0.58
87 0.63
88 0.72
89 0.75
90 0.79
91 0.81
92 0.78
93 0.73
94 0.7
95 0.67
96 0.62
97 0.64
98 0.65
99 0.66
100 0.63
101 0.62
102 0.56
103 0.53
104 0.57
105 0.58
106 0.57
107 0.56
108 0.54
109 0.53
110 0.54
111 0.51