Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A163JCD4

Protein Details
Accession A0A163JCD4    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
4-36IKLWASRQSSHRRCYRRRHRRSRSNVENKKTSHHydrophilic
NLS Segment(s)
PositionSequence
19-41RRRHRRSRSNVENKKTSHGKLKR
Subcellular Location(s) nucl 10, plas 9, cyto_nucl 8.333, mito_nucl 6.999, cyto 3.5, mito 2.5
Family & Domain DBs
Amino Acid Sequences MGNIKLWASRQSSHRRCYRRRHRRSRSNVENKKTSHGKLKRWANAEKEEFSSVRSFVRSYVRSFVRAFIHSFVVIVVVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.69
3 0.73
4 0.8
5 0.83
6 0.83
7 0.87
8 0.9
9 0.92
10 0.93
11 0.95
12 0.95
13 0.94
14 0.94
15 0.92
16 0.87
17 0.83
18 0.74
19 0.7
20 0.63
21 0.54
22 0.53
23 0.5
24 0.5
25 0.52
26 0.59
27 0.57
28 0.58
29 0.6
30 0.55
31 0.56
32 0.53
33 0.46
34 0.4
35 0.37
36 0.32
37 0.29
38 0.25
39 0.18
40 0.16
41 0.15
42 0.13
43 0.14
44 0.22
45 0.22
46 0.24
47 0.31
48 0.32
49 0.34
50 0.35
51 0.36
52 0.33
53 0.33
54 0.32
55 0.27
56 0.28
57 0.24
58 0.23
59 0.19