Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A163K9C5

Protein Details
Accession A0A163K9C5   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
88-113MELIKNSKDKRAKKLTKKRLGTFLRSHydrophilic
NLS Segment(s)
PositionSequence
93-116NSKDKRAKKLTKKRLGTFLRSKKK
Subcellular Location(s) mito 20, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038097  L36e_sf  
IPR000509  Ribosomal_L36e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01158  Ribosomal_L36e  
PROSITE View protein in PROSITE  
PS01190  RIBOSOMAL_L36E  
Amino Acid Sequences MAPQQKSGLAIGLNKGHITTRRELKQKPSYRQGVRIIDRMDGWMDGWMDGLGGKGLITMNGASSKRTTFVRSIVREVAGFAPYERRVMELIKNSKDKRAKKLTKKRLGTFLRSKKKIDELTNVIALSRRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.21
4 0.25
5 0.27
6 0.31
7 0.37
8 0.44
9 0.51
10 0.55
11 0.61
12 0.66
13 0.71
14 0.72
15 0.72
16 0.74
17 0.71
18 0.75
19 0.73
20 0.71
21 0.65
22 0.62
23 0.54
24 0.45
25 0.41
26 0.35
27 0.27
28 0.18
29 0.15
30 0.11
31 0.1
32 0.08
33 0.08
34 0.07
35 0.06
36 0.06
37 0.06
38 0.03
39 0.03
40 0.03
41 0.03
42 0.03
43 0.03
44 0.04
45 0.04
46 0.04
47 0.08
48 0.08
49 0.08
50 0.1
51 0.1
52 0.11
53 0.12
54 0.14
55 0.12
56 0.18
57 0.25
58 0.26
59 0.29
60 0.29
61 0.28
62 0.26
63 0.26
64 0.21
65 0.14
66 0.12
67 0.09
68 0.12
69 0.12
70 0.13
71 0.12
72 0.12
73 0.12
74 0.14
75 0.19
76 0.23
77 0.3
78 0.34
79 0.43
80 0.42
81 0.5
82 0.57
83 0.58
84 0.59
85 0.64
86 0.69
87 0.72
88 0.83
89 0.85
90 0.87
91 0.9
92 0.86
93 0.85
94 0.81
95 0.79
96 0.79
97 0.79
98 0.79
99 0.75
100 0.72
101 0.67
102 0.69
103 0.68
104 0.63
105 0.61
106 0.57
107 0.58
108 0.58
109 0.52
110 0.44