Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A163MBM7

Protein Details
Accession A0A163MBM7    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MKPFLKDCHVKQRRRFFQQYGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, cyto 6, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036397  RNaseH_sf  
IPR038717  Tc1-like_DDE_dom  
Gene Ontology GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF13358  DDE_3  
Amino Acid Sequences MKPFLKDCHVKQRRRFFQQYGALLEFLNEFENPVLMEDGAPLEWPAQSPDLNPIENLWKQMKDRVQNEFKEGMKLEHLEPILRQTWADIPIELINALIDSIPHRLEDLKAKKFKNFWKGTVQKILDADAADPVDDLDVDDVVVDLDGMVVGCDLDCCFCRIQQV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.85
3 0.78
4 0.79
5 0.78
6 0.73
7 0.67
8 0.59
9 0.49
10 0.41
11 0.36
12 0.27
13 0.18
14 0.15
15 0.09
16 0.08
17 0.07
18 0.08
19 0.07
20 0.08
21 0.08
22 0.07
23 0.07
24 0.06
25 0.07
26 0.07
27 0.07
28 0.06
29 0.06
30 0.06
31 0.06
32 0.08
33 0.09
34 0.09
35 0.09
36 0.16
37 0.18
38 0.18
39 0.17
40 0.17
41 0.21
42 0.21
43 0.24
44 0.2
45 0.2
46 0.21
47 0.27
48 0.31
49 0.33
50 0.36
51 0.41
52 0.46
53 0.44
54 0.48
55 0.46
56 0.41
57 0.36
58 0.33
59 0.25
60 0.2
61 0.2
62 0.16
63 0.15
64 0.15
65 0.12
66 0.12
67 0.14
68 0.13
69 0.12
70 0.11
71 0.08
72 0.11
73 0.12
74 0.12
75 0.09
76 0.09
77 0.1
78 0.1
79 0.09
80 0.07
81 0.05
82 0.04
83 0.04
84 0.03
85 0.03
86 0.04
87 0.05
88 0.06
89 0.06
90 0.07
91 0.07
92 0.09
93 0.19
94 0.26
95 0.33
96 0.39
97 0.41
98 0.45
99 0.51
100 0.57
101 0.58
102 0.56
103 0.51
104 0.55
105 0.59
106 0.61
107 0.63
108 0.56
109 0.48
110 0.44
111 0.41
112 0.32
113 0.27
114 0.22
115 0.14
116 0.14
117 0.11
118 0.1
119 0.08
120 0.07
121 0.06
122 0.06
123 0.05
124 0.04
125 0.04
126 0.04
127 0.04
128 0.04
129 0.04
130 0.03
131 0.03
132 0.03
133 0.03
134 0.03
135 0.03
136 0.03
137 0.03
138 0.03
139 0.04
140 0.04
141 0.07
142 0.08
143 0.1
144 0.12