Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2WQK3

Protein Details
Accession G2WQK3   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
183-208EEGSATKKKRTPKKTPVKKTAAKVEEHydrophilic
NLS Segment(s)
PositionSequence
166-202AKKRGGGAKKRASGADGEEGSATKKKRTPKKTPVKKT
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, mito 4, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001005  SANT/Myb  
KEGG vda:VDAG_00645  -  
CDD cd00167  SANT  
Amino Acid Sequences MPVLLRSASRAKRKSVTFNPELDYFYFTPDEHEDSETESESPEAMSETQKNGSANENGQGTTKAVPWTELDRAIVLNNILGQLHASSGKTLDWKAISEALPGRTMASMRAVWDRYRNDMKTAAAGEGDFVAVPNKQKTPRKKSTSKTAAAVASEDADAEDAPETPAKKRGGGAKKRASGADGEEGSATKKKRTPKKTPVKKTAAKVEEEEEASEEAETPAPAPAAADAEDAKNSDEEMKDTAEAKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.69
3 0.7
4 0.66
5 0.66
6 0.63
7 0.57
8 0.54
9 0.44
10 0.4
11 0.31
12 0.28
13 0.25
14 0.21
15 0.23
16 0.23
17 0.25
18 0.21
19 0.22
20 0.19
21 0.21
22 0.23
23 0.2
24 0.17
25 0.15
26 0.13
27 0.12
28 0.11
29 0.08
30 0.08
31 0.08
32 0.11
33 0.13
34 0.16
35 0.17
36 0.2
37 0.2
38 0.2
39 0.23
40 0.23
41 0.22
42 0.23
43 0.22
44 0.2
45 0.2
46 0.2
47 0.17
48 0.15
49 0.16
50 0.14
51 0.13
52 0.14
53 0.15
54 0.18
55 0.19
56 0.19
57 0.17
58 0.16
59 0.16
60 0.15
61 0.14
62 0.1
63 0.08
64 0.07
65 0.07
66 0.06
67 0.06
68 0.05
69 0.05
70 0.05
71 0.06
72 0.06
73 0.06
74 0.07
75 0.08
76 0.09
77 0.09
78 0.11
79 0.11
80 0.11
81 0.12
82 0.15
83 0.14
84 0.15
85 0.17
86 0.16
87 0.16
88 0.15
89 0.14
90 0.11
91 0.11
92 0.1
93 0.1
94 0.09
95 0.1
96 0.13
97 0.14
98 0.15
99 0.2
100 0.21
101 0.24
102 0.3
103 0.29
104 0.28
105 0.28
106 0.28
107 0.24
108 0.23
109 0.18
110 0.12
111 0.11
112 0.09
113 0.07
114 0.07
115 0.04
116 0.03
117 0.04
118 0.05
119 0.06
120 0.08
121 0.11
122 0.18
123 0.26
124 0.36
125 0.46
126 0.55
127 0.62
128 0.69
129 0.72
130 0.77
131 0.78
132 0.71
133 0.63
134 0.57
135 0.49
136 0.41
137 0.35
138 0.24
139 0.16
140 0.13
141 0.1
142 0.06
143 0.06
144 0.05
145 0.05
146 0.05
147 0.04
148 0.05
149 0.07
150 0.08
151 0.09
152 0.16
153 0.17
154 0.18
155 0.2
156 0.29
157 0.38
158 0.46
159 0.55
160 0.58
161 0.61
162 0.62
163 0.6
164 0.51
165 0.43
166 0.37
167 0.33
168 0.24
169 0.2
170 0.18
171 0.18
172 0.19
173 0.22
174 0.2
175 0.18
176 0.22
177 0.31
178 0.41
179 0.51
180 0.6
181 0.66
182 0.77
183 0.83
184 0.9
185 0.92
186 0.91
187 0.89
188 0.85
189 0.85
190 0.78
191 0.7
192 0.61
193 0.53
194 0.47
195 0.41
196 0.34
197 0.25
198 0.21
199 0.18
200 0.15
201 0.13
202 0.1
203 0.1
204 0.09
205 0.08
206 0.08
207 0.08
208 0.08
209 0.08
210 0.08
211 0.08
212 0.09
213 0.1
214 0.1
215 0.12
216 0.13
217 0.13
218 0.14
219 0.12
220 0.13
221 0.15
222 0.15
223 0.16
224 0.17
225 0.18
226 0.19