Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168MBA2

Protein Details
Accession A0A168MBA2    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
6-34RFAGYLKPPRSTRKRKIGIQKRNLPTKEEHydrophilic
125-147DTILNFRRPRPQNPKPRPYPDSPHydrophilic
NLS Segment(s)
PositionSequence
12-27KPPRSTRKRKIGIQKR
Subcellular Location(s) nucl 15.5, cyto_nucl 9, mito 6, plas 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MHRPPRFAGYLKPPRSTRKRKIGIQKRNLPTKEEEKTIILPLFADHFDIRTPASSSSAASLYGSIYSSLGTCYTLKLRLIFPTPTCQASHFLTIQPTALLLVTNVAALCFQLIIFSFLAPLMNKDTILNFRRPRPQNPKPRPYPDSPPPVSNGNSPMISVENLDSPVSKKVKWFFCFPLVHSGSRRSPPH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.75
3 0.78
4 0.77
5 0.78
6 0.81
7 0.82
8 0.89
9 0.89
10 0.89
11 0.89
12 0.89
13 0.87
14 0.88
15 0.8
16 0.73
17 0.69
18 0.67
19 0.61
20 0.53
21 0.47
22 0.4
23 0.4
24 0.4
25 0.33
26 0.24
27 0.2
28 0.17
29 0.17
30 0.14
31 0.14
32 0.1
33 0.1
34 0.11
35 0.11
36 0.11
37 0.11
38 0.12
39 0.11
40 0.13
41 0.13
42 0.13
43 0.14
44 0.14
45 0.12
46 0.11
47 0.1
48 0.08
49 0.08
50 0.08
51 0.06
52 0.06
53 0.06
54 0.06
55 0.06
56 0.06
57 0.07
58 0.07
59 0.08
60 0.09
61 0.11
62 0.12
63 0.14
64 0.14
65 0.16
66 0.19
67 0.2
68 0.19
69 0.22
70 0.23
71 0.22
72 0.22
73 0.2
74 0.2
75 0.2
76 0.21
77 0.17
78 0.16
79 0.15
80 0.15
81 0.14
82 0.11
83 0.09
84 0.06
85 0.05
86 0.04
87 0.03
88 0.04
89 0.04
90 0.04
91 0.04
92 0.03
93 0.03
94 0.03
95 0.03
96 0.03
97 0.03
98 0.03
99 0.03
100 0.05
101 0.06
102 0.06
103 0.06
104 0.06
105 0.07
106 0.07
107 0.08
108 0.09
109 0.09
110 0.1
111 0.1
112 0.12
113 0.18
114 0.21
115 0.28
116 0.29
117 0.34
118 0.44
119 0.48
120 0.57
121 0.6
122 0.67
123 0.7
124 0.78
125 0.82
126 0.82
127 0.86
128 0.82
129 0.77
130 0.77
131 0.74
132 0.73
133 0.66
134 0.59
135 0.53
136 0.51
137 0.46
138 0.4
139 0.35
140 0.28
141 0.25
142 0.23
143 0.22
144 0.19
145 0.17
146 0.15
147 0.13
148 0.11
149 0.12
150 0.13
151 0.13
152 0.13
153 0.2
154 0.22
155 0.22
156 0.26
157 0.33
158 0.42
159 0.45
160 0.49
161 0.47
162 0.53
163 0.56
164 0.52
165 0.54
166 0.48
167 0.49
168 0.46
169 0.48
170 0.46