Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2XH30

Protein Details
Accession G2XH30   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
49-75TAKPLPPAAPRPRRARRPRPRQQLLGGHydrophilic
NLS Segment(s)
PositionSequence
47-69RRTAKPLPPAAPRPRRARRPRPR
Subcellular Location(s) nucl 11, mito 6, cyto 6, cyto_mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR006571  TLDc_dom  
KEGG vda:VDAG_09462  -  
Pfam View protein in Pfam  
PF07534  TLD  
Amino Acid Sequences MWSSLTRHFSSADMAADDAAPGPRHLAHAHTDPLAGVTGAYTPPHQRRTAKPLPPAAPRPRRARRPRPRQQLLGGPASVQLATTASCHRGEEVKTCFLWRASALAALPPPPSADAAPARSTTIAPDLLTGEDAPAPPASPAAAAAAPPPPALRFKAFPYSGENEYCINCETGFLSMGAGDGHYGLWLDGGLARGRSGRSLTFGNEPLSDEGDKFGVLGVELWVLGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.14
4 0.14
5 0.11
6 0.11
7 0.1
8 0.1
9 0.11
10 0.12
11 0.14
12 0.15
13 0.16
14 0.19
15 0.23
16 0.25
17 0.24
18 0.24
19 0.21
20 0.21
21 0.18
22 0.13
23 0.09
24 0.06
25 0.07
26 0.07
27 0.08
28 0.09
29 0.16
30 0.23
31 0.28
32 0.33
33 0.38
34 0.44
35 0.53
36 0.61
37 0.61
38 0.62
39 0.65
40 0.65
41 0.68
42 0.7
43 0.71
44 0.7
45 0.7
46 0.74
47 0.75
48 0.8
49 0.83
50 0.85
51 0.86
52 0.88
53 0.91
54 0.92
55 0.9
56 0.85
57 0.79
58 0.76
59 0.7
60 0.62
61 0.51
62 0.4
63 0.32
64 0.27
65 0.22
66 0.13
67 0.09
68 0.05
69 0.06
70 0.07
71 0.07
72 0.09
73 0.1
74 0.1
75 0.11
76 0.13
77 0.14
78 0.19
79 0.21
80 0.22
81 0.22
82 0.22
83 0.23
84 0.19
85 0.19
86 0.13
87 0.11
88 0.09
89 0.09
90 0.09
91 0.09
92 0.09
93 0.09
94 0.09
95 0.07
96 0.07
97 0.07
98 0.07
99 0.06
100 0.09
101 0.1
102 0.12
103 0.13
104 0.13
105 0.13
106 0.13
107 0.13
108 0.11
109 0.11
110 0.09
111 0.08
112 0.08
113 0.08
114 0.08
115 0.08
116 0.08
117 0.06
118 0.06
119 0.06
120 0.06
121 0.06
122 0.06
123 0.05
124 0.06
125 0.05
126 0.05
127 0.05
128 0.05
129 0.05
130 0.05
131 0.06
132 0.08
133 0.08
134 0.08
135 0.08
136 0.08
137 0.11
138 0.13
139 0.15
140 0.16
141 0.2
142 0.28
143 0.28
144 0.28
145 0.32
146 0.33
147 0.33
148 0.32
149 0.3
150 0.23
151 0.23
152 0.23
153 0.18
154 0.14
155 0.11
156 0.11
157 0.1
158 0.1
159 0.1
160 0.08
161 0.07
162 0.07
163 0.07
164 0.06
165 0.06
166 0.05
167 0.04
168 0.04
169 0.04
170 0.04
171 0.04
172 0.04
173 0.04
174 0.04
175 0.05
176 0.07
177 0.08
178 0.08
179 0.09
180 0.11
181 0.12
182 0.14
183 0.16
184 0.15
185 0.17
186 0.19
187 0.22
188 0.25
189 0.28
190 0.28
191 0.26
192 0.28
193 0.26
194 0.27
195 0.25
196 0.19
197 0.18
198 0.16
199 0.15
200 0.13
201 0.11
202 0.08
203 0.08
204 0.08
205 0.07
206 0.07