Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A168NCK7

Protein Details
Accession A0A168NCK7    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
124-154AIEDHRKEKGMKKTKKSKKQKPMTLSFDPDEBasic
NLS Segment(s)
PositionSequence
107-112KTKKKA
128-144HRKEKGMKKTKKSKKQK
Subcellular Location(s) nucl 16.5, cyto_nucl 12.833, mito_nucl 10.666, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR027911  DUF4604  
Pfam View protein in Pfam  
PF15377  DUF4604  
Amino Acid Sequences MAPKELTPHQVSKGLEYVHKEPAFLARLKGTSKAQEKAKQKFVDYEDGQDDEDYNELDGAQVVELDSKGKEIHKDTETKDDSEKEEQEEEPAGPAVDENGRILFRAKTKKKATMGSTKRSLEDAIEDHRKEKGMKKTKKSKKQKPMTLSFDPDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.33
3 0.34
4 0.34
5 0.38
6 0.37
7 0.34
8 0.29
9 0.33
10 0.34
11 0.29
12 0.28
13 0.22
14 0.24
15 0.26
16 0.29
17 0.27
18 0.31
19 0.35
20 0.39
21 0.44
22 0.49
23 0.56
24 0.6
25 0.66
26 0.6
27 0.56
28 0.56
29 0.52
30 0.53
31 0.45
32 0.42
33 0.35
34 0.33
35 0.31
36 0.25
37 0.22
38 0.13
39 0.12
40 0.08
41 0.06
42 0.05
43 0.05
44 0.05
45 0.04
46 0.04
47 0.04
48 0.03
49 0.03
50 0.04
51 0.04
52 0.05
53 0.04
54 0.05
55 0.06
56 0.07
57 0.1
58 0.12
59 0.17
60 0.19
61 0.23
62 0.24
63 0.32
64 0.33
65 0.32
66 0.31
67 0.28
68 0.28
69 0.28
70 0.27
71 0.2
72 0.2
73 0.19
74 0.18
75 0.17
76 0.14
77 0.11
78 0.1
79 0.08
80 0.06
81 0.06
82 0.06
83 0.06
84 0.06
85 0.06
86 0.07
87 0.07
88 0.08
89 0.09
90 0.11
91 0.17
92 0.27
93 0.32
94 0.41
95 0.47
96 0.54
97 0.58
98 0.63
99 0.63
100 0.63
101 0.66
102 0.64
103 0.66
104 0.6
105 0.56
106 0.5
107 0.44
108 0.34
109 0.3
110 0.24
111 0.24
112 0.3
113 0.3
114 0.29
115 0.31
116 0.32
117 0.32
118 0.38
119 0.41
120 0.45
121 0.54
122 0.64
123 0.73
124 0.81
125 0.89
126 0.92
127 0.92
128 0.93
129 0.94
130 0.93
131 0.92
132 0.91
133 0.89
134 0.85