Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168QY90

Protein Details
Accession A0A168QY90   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
9-47IFEQLQSRHYRRRQRYRRRQRYRRRQRRSESKSLKNDERBasic
NLS Segment(s)
PositionSequence
19-40RRRQRYRRRQRYRRRQRRSESK
Subcellular Location(s) nucl 14, mito_nucl 11.833, cyto_nucl 9.833, mito 8.5
Family & Domain DBs
Amino Acid Sequences MDWTTGWGIFEQLQSRHYRRRQRYRRRQRYRRRQRRSESKSLKNDERCKWQFVSHGKQKNRMLRREDLPYVRRRSSLVVVASGAVQMPMERKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.32
3 0.4
4 0.47
5 0.55
6 0.62
7 0.72
8 0.8
9 0.84
10 0.9
11 0.93
12 0.95
13 0.96
14 0.97
15 0.97
16 0.97
17 0.97
18 0.97
19 0.96
20 0.95
21 0.94
22 0.94
23 0.92
24 0.91
25 0.89
26 0.87
27 0.86
28 0.82
29 0.79
30 0.76
31 0.75
32 0.67
33 0.68
34 0.6
35 0.55
36 0.5
37 0.44
38 0.42
39 0.42
40 0.47
41 0.46
42 0.53
43 0.52
44 0.59
45 0.64
46 0.66
47 0.67
48 0.65
49 0.62
50 0.6
51 0.62
52 0.6
53 0.59
54 0.58
55 0.56
56 0.58
57 0.59
58 0.54
59 0.51
60 0.45
61 0.44
62 0.4
63 0.4
64 0.33
65 0.28
66 0.26
67 0.25
68 0.24
69 0.19
70 0.15
71 0.09
72 0.07
73 0.06