Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A168PGP2

Protein Details
Accession A0A168PGP2    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
75-104PRPPGSKRMTVPKPKTKSKRIHPANLSEKNHydrophilic
NLS Segment(s)
PositionSequence
79-95GSKRMTVPKPKTKSKRI
Subcellular Location(s) nucl 21.5, cyto_nucl 14.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MGCCISTEEASIHEVVFDENGIARRVPKGQGTHLIHVYQDQETNIEKKTRPSLDDHHTPKPQMTPLPRPETAYYPRPPGSKRMTVPKPKTKSKRIHPANLSEKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.09
4 0.07
5 0.06
6 0.07
7 0.09
8 0.1
9 0.1
10 0.11
11 0.13
12 0.16
13 0.18
14 0.21
15 0.23
16 0.25
17 0.35
18 0.38
19 0.4
20 0.39
21 0.37
22 0.32
23 0.3
24 0.28
25 0.19
26 0.15
27 0.11
28 0.11
29 0.12
30 0.14
31 0.14
32 0.16
33 0.16
34 0.18
35 0.24
36 0.24
37 0.24
38 0.27
39 0.31
40 0.34
41 0.42
42 0.44
43 0.44
44 0.44
45 0.43
46 0.4
47 0.37
48 0.33
49 0.3
50 0.31
51 0.33
52 0.38
53 0.45
54 0.44
55 0.45
56 0.45
57 0.45
58 0.44
59 0.43
60 0.38
61 0.38
62 0.4
63 0.41
64 0.41
65 0.43
66 0.45
67 0.46
68 0.48
69 0.52
70 0.59
71 0.66
72 0.74
73 0.77
74 0.77
75 0.8
76 0.85
77 0.85
78 0.85
79 0.85
80 0.87
81 0.85
82 0.88
83 0.84
84 0.85