Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168SLT3

Protein Details
Accession A0A168SLT3    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
139-164SEYKDGGDKKDTKKKSNKKRTAKWLLBasic
NLS Segment(s)
PositionSequence
147-161KKDTKKKSNKKRTAX
Subcellular Location(s) cyto 12.5, cyto_nucl 12.333, nucl 9, mito_nucl 5.999, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001357  BRCT_dom  
IPR036420  BRCT_dom_sf  
IPR010613  PES  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
PROSITE View protein in PROSITE  
PS50172  BRCT  
Amino Acid Sequences MIRACGGQVSWDASVGGVPPFPESDERITIQVCDRPKVNNRVLSRAYVQPQWIADCVNSRKLIKASLYEPGQLLPPHLSPFVEAKEGDYVPASGLEEEEEDEEDESETEQVEQQSTAPAAEVDDYEKELKAEAAGVTFSEYKDGGDKKDTKKKSNKKRTAXXXXKWLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.1
4 0.08
5 0.08
6 0.08
7 0.09
8 0.11
9 0.13
10 0.15
11 0.19
12 0.21
13 0.22
14 0.23
15 0.23
16 0.22
17 0.23
18 0.24
19 0.22
20 0.22
21 0.22
22 0.27
23 0.35
24 0.42
25 0.46
26 0.49
27 0.5
28 0.54
29 0.55
30 0.51
31 0.47
32 0.43
33 0.4
34 0.34
35 0.32
36 0.26
37 0.25
38 0.23
39 0.2
40 0.16
41 0.13
42 0.17
43 0.19
44 0.21
45 0.23
46 0.22
47 0.24
48 0.25
49 0.27
50 0.22
51 0.22
52 0.19
53 0.23
54 0.23
55 0.21
56 0.2
57 0.18
58 0.18
59 0.15
60 0.15
61 0.11
62 0.1
63 0.11
64 0.11
65 0.1
66 0.1
67 0.11
68 0.11
69 0.11
70 0.1
71 0.1
72 0.12
73 0.12
74 0.11
75 0.1
76 0.09
77 0.07
78 0.08
79 0.07
80 0.05
81 0.05
82 0.05
83 0.05
84 0.05
85 0.05
86 0.05
87 0.05
88 0.06
89 0.06
90 0.06
91 0.06
92 0.06
93 0.05
94 0.05
95 0.05
96 0.06
97 0.07
98 0.07
99 0.07
100 0.07
101 0.09
102 0.09
103 0.08
104 0.07
105 0.07
106 0.06
107 0.07
108 0.07
109 0.07
110 0.08
111 0.1
112 0.11
113 0.11
114 0.11
115 0.1
116 0.1
117 0.09
118 0.09
119 0.08
120 0.07
121 0.07
122 0.07
123 0.1
124 0.11
125 0.1
126 0.11
127 0.1
128 0.1
129 0.17
130 0.19
131 0.19
132 0.27
133 0.35
134 0.42
135 0.52
136 0.59
137 0.63
138 0.72
139 0.8
140 0.83
141 0.87
142 0.89
143 0.9
144 0.93