Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168PRB3

Protein Details
Accession A0A168PRB3   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
42-63ATEPAPKPQKKKKPPTIWASPAHydrophilic
NLS Segment(s)
PositionSequence
47-55PKPQKKKKP
Subcellular Location(s) plas 14, mito 4, extr 3, golg 3, cyto 1, E.R. 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MRFSILTLTLVVLFFISHVCATAMPEPKMDGLTLIRRAEAAATEPAPKPQKKKKPPTIWASPAILQDGTLFYIAISISTLLWCTGKGVDMTLDQQERQAEYVARR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.06
4 0.05
5 0.06
6 0.06
7 0.07
8 0.09
9 0.15
10 0.2
11 0.2
12 0.2
13 0.2
14 0.21
15 0.21
16 0.18
17 0.14
18 0.11
19 0.15
20 0.2
21 0.19
22 0.18
23 0.18
24 0.18
25 0.17
26 0.14
27 0.12
28 0.09
29 0.1
30 0.12
31 0.13
32 0.18
33 0.23
34 0.25
35 0.31
36 0.39
37 0.48
38 0.56
39 0.67
40 0.73
41 0.77
42 0.83
43 0.83
44 0.82
45 0.76
46 0.69
47 0.6
48 0.52
49 0.42
50 0.35
51 0.27
52 0.18
53 0.14
54 0.11
55 0.09
56 0.07
57 0.06
58 0.05
59 0.06
60 0.05
61 0.05
62 0.05
63 0.05
64 0.05
65 0.05
66 0.06
67 0.06
68 0.06
69 0.06
70 0.07
71 0.07
72 0.09
73 0.09
74 0.09
75 0.1
76 0.11
77 0.14
78 0.18
79 0.2
80 0.18
81 0.21
82 0.22
83 0.22
84 0.22
85 0.23