Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A168QPI4

Protein Details
Accession A0A168QPI4   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MSQTLRKSKQRTPRQNSNVFTAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, cyto 9, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR011992  EF-hand-dom_pair  
IPR002048  EF_hand_dom  
Gene Ontology GO:0005509  F:calcium ion binding  
Pfam View protein in Pfam  
PF13833  EF-hand_8  
PROSITE View protein in PROSITE  
PS50222  EF_HAND_2  
CDD cd00051  EFh  
Amino Acid Sequences MSQTLRKSKQRTPRQNSNVFTAFDKRQIKEFKEAFRIMDTNGDEIVDAKDLQVTFDRIGQPISPELLTKMLGEAPGPINFTVFLTLMADKLTGTDPEHVITNAFAAFDTDNTGTIDADYLRECMTTMGDRFTDEEVDVMFKGPALDDQGKFDYREFVRVLKHGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.87
3 0.82
4 0.79
5 0.72
6 0.62
7 0.55
8 0.5
9 0.42
10 0.42
11 0.45
12 0.38
13 0.42
14 0.47
15 0.48
16 0.52
17 0.54
18 0.52
19 0.54
20 0.54
21 0.47
22 0.44
23 0.41
24 0.32
25 0.33
26 0.27
27 0.2
28 0.19
29 0.17
30 0.13
31 0.13
32 0.13
33 0.09
34 0.08
35 0.06
36 0.09
37 0.09
38 0.1
39 0.11
40 0.12
41 0.11
42 0.15
43 0.16
44 0.14
45 0.15
46 0.14
47 0.13
48 0.12
49 0.13
50 0.1
51 0.09
52 0.09
53 0.1
54 0.1
55 0.08
56 0.08
57 0.07
58 0.07
59 0.07
60 0.08
61 0.08
62 0.08
63 0.09
64 0.08
65 0.08
66 0.08
67 0.08
68 0.08
69 0.06
70 0.06
71 0.06
72 0.06
73 0.06
74 0.06
75 0.06
76 0.05
77 0.05
78 0.06
79 0.06
80 0.07
81 0.09
82 0.09
83 0.1
84 0.11
85 0.1
86 0.1
87 0.09
88 0.08
89 0.06
90 0.06
91 0.05
92 0.05
93 0.05
94 0.05
95 0.08
96 0.08
97 0.08
98 0.09
99 0.09
100 0.08
101 0.08
102 0.09
103 0.06
104 0.07
105 0.07
106 0.07
107 0.07
108 0.07
109 0.08
110 0.07
111 0.09
112 0.11
113 0.12
114 0.13
115 0.13
116 0.14
117 0.16
118 0.16
119 0.16
120 0.12
121 0.12
122 0.1
123 0.11
124 0.11
125 0.1
126 0.09
127 0.08
128 0.08
129 0.08
130 0.09
131 0.14
132 0.19
133 0.19
134 0.23
135 0.27
136 0.29
137 0.3
138 0.29
139 0.31
140 0.27
141 0.31
142 0.29
143 0.28
144 0.31