Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A168LFV4

Protein Details
Accession A0A168LFV4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
78-105RYGLHHRKSLHKVPKFTKKTQRTSPPGFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24.5, cyto_mito 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGPFRPSFVAQGGLLWKNPFRMSATRKANVRKRLRDVDQVIAAVEASGVRCKALDEALVLPKESEMHARDKYTVFSRYGLHHRKSLHKVPKFTKKTQRTSPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.22
4 0.21
5 0.21
6 0.22
7 0.21
8 0.2
9 0.27
10 0.32
11 0.4
12 0.46
13 0.48
14 0.54
15 0.62
16 0.66
17 0.68
18 0.71
19 0.7
20 0.7
21 0.73
22 0.72
23 0.71
24 0.66
25 0.6
26 0.52
27 0.43
28 0.35
29 0.27
30 0.22
31 0.13
32 0.09
33 0.05
34 0.04
35 0.04
36 0.04
37 0.04
38 0.04
39 0.05
40 0.05
41 0.06
42 0.06
43 0.06
44 0.08
45 0.12
46 0.12
47 0.12
48 0.11
49 0.11
50 0.11
51 0.1
52 0.12
53 0.11
54 0.16
55 0.18
56 0.2
57 0.22
58 0.22
59 0.25
60 0.25
61 0.26
62 0.22
63 0.22
64 0.23
65 0.26
66 0.36
67 0.41
68 0.4
69 0.41
70 0.44
71 0.51
72 0.58
73 0.63
74 0.63
75 0.62
76 0.68
77 0.73
78 0.8
79 0.79
80 0.8
81 0.81
82 0.81
83 0.83
84 0.84
85 0.86