Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A168NR12

Protein Details
Accession A0A168NR12    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
4-30IPKTRNTYCKGLKCRKHTPHKVTQYKAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, mito 6, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
Amino Acid Sequences MVNIPKTRNTYCKGLKCRKHTPHKVTQYKAGKASLFAQGKRRYDRKQSGYGGQTKPVFHKKVNANK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.75
3 0.76
4 0.83
5 0.83
6 0.85
7 0.86
8 0.84
9 0.84
10 0.87
11 0.86
12 0.78
13 0.78
14 0.74
15 0.67
16 0.6
17 0.52
18 0.41
19 0.34
20 0.33
21 0.31
22 0.26
23 0.25
24 0.3
25 0.34
26 0.39
27 0.45
28 0.5
29 0.47
30 0.55
31 0.63
32 0.61
33 0.64
34 0.64
35 0.64
36 0.64
37 0.67
38 0.59
39 0.55
40 0.52
41 0.45
42 0.49
43 0.5
44 0.48
45 0.42
46 0.49