FuNGI

A0A163JX92

Protein Details

Accession

A0A163JX92

Localization Confidence

Medium

Confidence Score

13.2

NoLS Segment(s)

Position	Sequence	Protein Nature
513-542	QDEWTKAQQHGSKKKKHRHHKRRVRIPVTA	Basic

NLS Segment(s)

Position	Sequence
523-537	GSKKKKHRHHKRRVR

Subcellular Location(s)

nucl 21, cyto_nucl 14, cyto 5

Family & Domain DBs

InterPro	View protein in InterPro IPR036533 BAG_dom_sf IPR003103 BAG_domain
Gene Ontology	GO:0051087 F:protein-folding chaperone binding
Pfam	View protein in Pfam PF02179 BAG

Amino Acid Sequences

MYSTYILVHPRTQQLQNALTLEDYQQIQALLEYVLQRQQQGFLQHVGDREHVRLVQALYNNKLMQLDYRRQRAAQLQRLLQHYHDQFHDCDRARLLAALEKQRAQQAFRRFIEAYYQQQSNEAQDTCEIDADNKPAIPSQAPVSTTPTAAQIETQQTPEEDEGEDQEEEEPIDDAYEQYQTQQLEGLLKHIFEKNTKAQQSGCNDSKEDDNDEYMYAPVREDPQDEQTVADLLPLLSAENDTTTRPVDPPPEKAPSPPSQTPATKNDEASFLPDNVLPLQDVLDELIRTPTPAMKSSEDQTPSRVHAPKPPAPAMKSSENSTASRAPAPKPPAPAMKSSENSTPARASAPKPPAPAMKTSEDPTLSRAPAPKPSASVQPTKTQTAYPPPPVPPPKLDTSEPDTSDSDAHPDRQKKLDQLAAVEQELDRLATENKDNSITRLPLQYQVNDQGRLFLDGNTPNNRRFLTFEDAIIRCMIQLDQVLSDGDSLIRDRRRQAVRKAEALLEPVDRHKQDEWTKAQQHGSKKKKHRHHKRRVRIPVTA

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.46
2	0.47
3	0.47
4	0.43
5	0.37
6	0.31
7	0.29
8	0.25
9	0.21
10	0.19
11	0.15
12	0.15
13	0.14
14	0.14
15	0.12
16	0.12
17	0.09
18	0.1
19	0.11
20	0.12
21	0.17
22	0.18
23	0.2
24	0.2
25	0.22
26	0.24
27	0.26
28	0.28
29	0.26
30	0.28
31	0.28
32	0.3
33	0.3
34	0.3
35	0.29
36	0.28
37	0.28
38	0.26
39	0.24
40	0.24
41	0.24
42	0.24
43	0.27
44	0.31
45	0.3
46	0.35
47	0.34
48	0.31
49	0.3
50	0.26
51	0.28
52	0.31
53	0.37
54	0.41
55	0.48
56	0.49
57	0.49
58	0.53
59	0.55
60	0.58
61	0.58
62	0.57
63	0.55
64	0.58
65	0.61
66	0.58
67	0.51
68	0.49
69	0.42
70	0.38
71	0.37
72	0.34
73	0.32
74	0.35
75	0.41
76	0.34
77	0.34
78	0.32
79	0.3
80	0.28
81	0.28
82	0.24
83	0.22
84	0.27
85	0.31
86	0.33
87	0.33
88	0.34
89	0.38
90	0.38
91	0.36
92	0.37
93	0.39
94	0.46
95	0.45
96	0.49
97	0.44
98	0.42
99	0.46
100	0.44
101	0.41
102	0.36
103	0.36
104	0.31
105	0.33
106	0.33
107	0.28
108	0.28
109	0.22
110	0.18
111	0.18
112	0.2
113	0.18
114	0.18
115	0.15
116	0.12
117	0.14
118	0.16
119	0.16
120	0.14
121	0.14
122	0.14
123	0.15
124	0.14
125	0.13
126	0.14
127	0.17
128	0.18
129	0.19
130	0.23
131	0.23
132	0.22
133	0.21
134	0.21
135	0.18
136	0.17
137	0.16
138	0.14
139	0.18
140	0.19
141	0.19
142	0.17
143	0.16
144	0.18
145	0.18
146	0.15
147	0.11
148	0.1
149	0.11
150	0.12
151	0.12
152	0.1
153	0.1
154	0.09
155	0.09
156	0.09
157	0.08
158	0.05
159	0.05
160	0.05
161	0.05
162	0.05
163	0.07
164	0.07
165	0.07
166	0.1
167	0.1
168	0.1
169	0.11
170	0.11
171	0.13
172	0.13
173	0.15
174	0.12
175	0.13
176	0.14
177	0.16
178	0.17
179	0.16
180	0.21
181	0.26
182	0.34
183	0.35
184	0.34
185	0.34
186	0.38
187	0.42
188	0.44
189	0.41
190	0.34
191	0.33
192	0.33
193	0.33
194	0.29
195	0.27
196	0.2
197	0.18
198	0.16
199	0.16
200	0.15
201	0.13
202	0.12
203	0.08
204	0.08
205	0.08
206	0.09
207	0.1
208	0.11
209	0.13
210	0.16
211	0.17
212	0.17
213	0.17
214	0.15
215	0.14
216	0.12
217	0.1
218	0.06
219	0.05
220	0.05
221	0.04
222	0.04
223	0.03
224	0.04
225	0.04
226	0.04
227	0.05
228	0.06
229	0.07
230	0.07
231	0.08
232	0.09
233	0.11
234	0.17
235	0.19
236	0.23
237	0.26
238	0.3
239	0.29
240	0.3
241	0.34
242	0.32
243	0.37
244	0.34
245	0.33
246	0.34
247	0.36
248	0.39
249	0.38
250	0.4
251	0.34
252	0.33
253	0.31
254	0.28
255	0.25
256	0.24
257	0.2
258	0.14
259	0.13
260	0.12
261	0.12
262	0.1
263	0.1
264	0.07
265	0.06
266	0.06
267	0.05
268	0.04
269	0.04
270	0.05
271	0.04
272	0.05
273	0.06
274	0.06
275	0.06
276	0.06
277	0.08
278	0.09
279	0.12
280	0.15
281	0.16
282	0.18
283	0.2
284	0.25
285	0.26
286	0.25
287	0.25
288	0.24
289	0.23
290	0.28
291	0.29
292	0.25
293	0.29
294	0.36
295	0.38
296	0.42
297	0.45
298	0.42
299	0.4
300	0.43
301	0.41
302	0.4
303	0.36
304	0.33
305	0.33
306	0.32
307	0.32
308	0.31
309	0.28
310	0.23
311	0.26
312	0.26
313	0.23
314	0.26
315	0.32
316	0.32
317	0.33
318	0.36
319	0.39
320	0.39
321	0.41
322	0.39
323	0.39
324	0.38
325	0.36
326	0.36
327	0.34
328	0.33
329	0.31
330	0.27
331	0.21
332	0.22
333	0.23
334	0.21
335	0.25
336	0.31
337	0.32
338	0.34
339	0.36
340	0.38
341	0.37
342	0.4
343	0.36
344	0.32
345	0.31
346	0.32
347	0.33
348	0.29
349	0.27
350	0.27
351	0.26
352	0.23
353	0.23
354	0.25
355	0.24
356	0.3
357	0.33
358	0.3
359	0.29
360	0.31
361	0.37
362	0.36
363	0.41
364	0.36
365	0.41
366	0.43
367	0.43
368	0.41
369	0.35
370	0.35
371	0.37
372	0.4
373	0.39
374	0.39
375	0.39
376	0.47
377	0.5
378	0.5
379	0.45
380	0.44
381	0.43
382	0.43
383	0.43
384	0.39
385	0.41
386	0.43
387	0.4
388	0.38
389	0.34
390	0.3
391	0.3
392	0.25
393	0.24
394	0.19
395	0.23
396	0.27
397	0.31
398	0.34
399	0.38
400	0.42
401	0.42
402	0.46
403	0.46
404	0.4
405	0.38
406	0.39
407	0.36
408	0.32
409	0.28
410	0.22
411	0.18
412	0.17
413	0.13
414	0.08
415	0.08
416	0.09
417	0.11
418	0.14
419	0.15
420	0.17
421	0.21
422	0.22
423	0.23
424	0.28
425	0.27
426	0.27
427	0.3
428	0.3
429	0.32
430	0.35
431	0.34
432	0.32
433	0.4
434	0.41
435	0.39
436	0.37
437	0.34
438	0.32
439	0.34
440	0.3
441	0.22
442	0.24
443	0.26
444	0.31
445	0.36
446	0.38
447	0.36
448	0.4
449	0.39
450	0.36
451	0.34
452	0.34
453	0.34
454	0.32
455	0.33
456	0.36
457	0.36
458	0.35
459	0.32
460	0.26
461	0.18
462	0.18
463	0.15
464	0.1
465	0.11
466	0.11
467	0.11
468	0.12
469	0.13
470	0.12
471	0.12
472	0.1
473	0.08
474	0.08
475	0.1
476	0.16
477	0.21
478	0.25
479	0.29
480	0.38
481	0.48
482	0.55
483	0.64
484	0.68
485	0.69
486	0.71
487	0.71
488	0.65
489	0.57
490	0.51
491	0.44
492	0.36
493	0.31
494	0.3
495	0.35
496	0.31
497	0.33
498	0.33
499	0.39
500	0.44
501	0.51
502	0.54
503	0.56
504	0.61
505	0.63
506	0.68
507	0.65
508	0.68
509	0.69
510	0.72
511	0.72
512	0.78
513	0.82
514	0.85
515	0.91
516	0.92
517	0.93
518	0.94
519	0.95
520	0.96
521	0.96
522	0.97

A0A163JX92

3D AlphaFold-predicted Structure Viewer