Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2WU55

Protein Details
Accession G2WU55    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
324-349AIEESRREKHQDKRKQAPGDEQKQSSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, cyto 3.5, cyto_nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR023398  TIF_eIF4e-like  
IPR001040  TIF_eIF_4E  
Gene Ontology GO:0003723  F:RNA binding  
GO:0003743  F:translation initiation factor activity  
KEGG vda:VDAG_01328  -  
Pfam View protein in Pfam  
PF01652  IF4E  
Amino Acid Sequences MDNNLWTRRTNSGKLSLSTPSHGTSTSTGGDSARNGSGSFSKRFGGATSSQGKNDPFSATAATTPGGSSLASPTTGASNAFGLGSGAFASFGSAKTPKTPGNPFELAMGKAPASKTPGADGKAPSMASIAETGASANFRTGQGSQTSSARGSSEVARPQAGLKVHPLKYEWVTWCRPCQPKGQPYEEPSRSLSSASATSSTPRSCRWDGSTTFSREASGPSGRTRSTRSGGKWVLRLKKGIADRYWEDTPLCAPWRGLSREVGEEICGGVVSIRNGEDVISIWTRSTGGRVLKIRETWKNYLQCPPNTIFEFKSHDESIQHRAAIEESRREKHQDKRKQAPGDEQKQSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.53
3 0.51
4 0.47
5 0.44
6 0.4
7 0.33
8 0.29
9 0.27
10 0.27
11 0.22
12 0.23
13 0.21
14 0.2
15 0.18
16 0.18
17 0.19
18 0.18
19 0.19
20 0.17
21 0.16
22 0.15
23 0.17
24 0.23
25 0.26
26 0.27
27 0.26
28 0.25
29 0.25
30 0.26
31 0.25
32 0.23
33 0.21
34 0.25
35 0.31
36 0.33
37 0.33
38 0.36
39 0.36
40 0.33
41 0.32
42 0.27
43 0.2
44 0.19
45 0.2
46 0.17
47 0.17
48 0.16
49 0.14
50 0.12
51 0.11
52 0.1
53 0.08
54 0.07
55 0.07
56 0.08
57 0.09
58 0.09
59 0.09
60 0.09
61 0.1
62 0.11
63 0.11
64 0.09
65 0.09
66 0.09
67 0.08
68 0.08
69 0.07
70 0.06
71 0.06
72 0.05
73 0.04
74 0.04
75 0.04
76 0.05
77 0.06
78 0.06
79 0.09
80 0.11
81 0.11
82 0.14
83 0.18
84 0.21
85 0.26
86 0.32
87 0.32
88 0.38
89 0.38
90 0.36
91 0.35
92 0.34
93 0.29
94 0.24
95 0.22
96 0.14
97 0.15
98 0.15
99 0.13
100 0.15
101 0.15
102 0.15
103 0.17
104 0.21
105 0.21
106 0.24
107 0.24
108 0.22
109 0.23
110 0.22
111 0.19
112 0.15
113 0.13
114 0.1
115 0.09
116 0.07
117 0.05
118 0.05
119 0.05
120 0.05
121 0.06
122 0.05
123 0.05
124 0.06
125 0.06
126 0.08
127 0.08
128 0.1
129 0.11
130 0.13
131 0.14
132 0.14
133 0.15
134 0.14
135 0.14
136 0.12
137 0.11
138 0.11
139 0.12
140 0.16
141 0.17
142 0.18
143 0.18
144 0.17
145 0.18
146 0.2
147 0.17
148 0.14
149 0.17
150 0.23
151 0.24
152 0.25
153 0.25
154 0.24
155 0.25
156 0.29
157 0.26
158 0.23
159 0.26
160 0.27
161 0.29
162 0.34
163 0.37
164 0.34
165 0.4
166 0.43
167 0.47
168 0.51
169 0.54
170 0.51
171 0.51
172 0.58
173 0.51
174 0.45
175 0.4
176 0.36
177 0.3
178 0.26
179 0.22
180 0.14
181 0.14
182 0.12
183 0.11
184 0.1
185 0.11
186 0.14
187 0.15
188 0.14
189 0.16
190 0.21
191 0.22
192 0.24
193 0.27
194 0.31
195 0.31
196 0.37
197 0.42
198 0.39
199 0.39
200 0.37
201 0.33
202 0.27
203 0.26
204 0.23
205 0.19
206 0.17
207 0.18
208 0.21
209 0.21
210 0.22
211 0.26
212 0.27
213 0.29
214 0.34
215 0.34
216 0.4
217 0.45
218 0.46
219 0.48
220 0.5
221 0.53
222 0.5
223 0.49
224 0.41
225 0.42
226 0.44
227 0.43
228 0.37
229 0.36
230 0.36
231 0.4
232 0.4
233 0.34
234 0.29
235 0.24
236 0.23
237 0.21
238 0.2
239 0.15
240 0.14
241 0.16
242 0.23
243 0.26
244 0.26
245 0.26
246 0.26
247 0.28
248 0.29
249 0.26
250 0.2
251 0.17
252 0.15
253 0.12
254 0.09
255 0.06
256 0.05
257 0.07
258 0.07
259 0.07
260 0.08
261 0.08
262 0.08
263 0.08
264 0.08
265 0.07
266 0.11
267 0.11
268 0.11
269 0.11
270 0.11
271 0.12
272 0.12
273 0.14
274 0.15
275 0.17
276 0.24
277 0.29
278 0.33
279 0.37
280 0.43
281 0.48
282 0.51
283 0.55
284 0.54
285 0.58
286 0.61
287 0.59
288 0.63
289 0.63
290 0.58
291 0.56
292 0.53
293 0.51
294 0.47
295 0.47
296 0.4
297 0.37
298 0.4
299 0.38
300 0.41
301 0.35
302 0.34
303 0.34
304 0.36
305 0.38
306 0.36
307 0.33
308 0.27
309 0.27
310 0.27
311 0.31
312 0.33
313 0.35
314 0.37
315 0.42
316 0.45
317 0.51
318 0.56
319 0.59
320 0.64
321 0.66
322 0.7
323 0.76
324 0.82
325 0.84
326 0.82
327 0.83
328 0.84
329 0.82