Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177DGR4

Protein Details
Accession A0A177DGR4    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
143-163FSKILKKWDKTSKVRCHYLRIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito_nucl 11.833, mito 10.5, cyto_nucl 8.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR004331  SPX_dom  
IPR031142  SPX_prot  
Gene Ontology GO:0016036  P:cellular response to phosphate starvation  
KEGG aalt:CC77DRAFT_225468  -  
Pfam View protein in Pfam  
PF03105  SPX  
PROSITE View protein in PROSITE  
PS51382  SPX  
CDD cd14483  SPX_PHO81_NUC-2_like  
Amino Acid Sequences MKFGKHIQKRQLEIPEYAASFVDYKALKKLIKKLGATPVIPPQSEGFHHESLDPQSSLQANKATFFFRVERELEKVNTFYLQKEAELRLRLTTLLDKKRVMQQHPQSVSKTSSRYVALEEGLKQFSMDLNKLEQFVEVNETAFSKILKKWDKTSKVRCHYLRIYRHWLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.5
3 0.42
4 0.38
5 0.3
6 0.22
7 0.19
8 0.17
9 0.17
10 0.14
11 0.14
12 0.18
13 0.23
14 0.25
15 0.29
16 0.39
17 0.43
18 0.49
19 0.5
20 0.51
21 0.55
22 0.57
23 0.52
24 0.46
25 0.45
26 0.42
27 0.39
28 0.35
29 0.27
30 0.24
31 0.25
32 0.27
33 0.24
34 0.21
35 0.22
36 0.21
37 0.22
38 0.22
39 0.24
40 0.19
41 0.14
42 0.15
43 0.16
44 0.16
45 0.16
46 0.18
47 0.15
48 0.16
49 0.17
50 0.16
51 0.15
52 0.17
53 0.16
54 0.14
55 0.17
56 0.18
57 0.19
58 0.2
59 0.22
60 0.21
61 0.2
62 0.19
63 0.16
64 0.17
65 0.15
66 0.13
67 0.13
68 0.12
69 0.11
70 0.13
71 0.14
72 0.15
73 0.16
74 0.16
75 0.14
76 0.14
77 0.14
78 0.13
79 0.17
80 0.21
81 0.24
82 0.27
83 0.27
84 0.28
85 0.35
86 0.39
87 0.37
88 0.4
89 0.43
90 0.5
91 0.54
92 0.55
93 0.5
94 0.47
95 0.46
96 0.4
97 0.35
98 0.26
99 0.25
100 0.23
101 0.22
102 0.21
103 0.2
104 0.17
105 0.17
106 0.18
107 0.17
108 0.17
109 0.16
110 0.14
111 0.12
112 0.13
113 0.15
114 0.15
115 0.14
116 0.16
117 0.18
118 0.19
119 0.19
120 0.16
121 0.13
122 0.13
123 0.16
124 0.13
125 0.12
126 0.12
127 0.13
128 0.13
129 0.13
130 0.13
131 0.11
132 0.14
133 0.23
134 0.31
135 0.34
136 0.43
137 0.53
138 0.62
139 0.69
140 0.78
141 0.79
142 0.8
143 0.86
144 0.8
145 0.79
146 0.78
147 0.78
148 0.77
149 0.74