Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177DBG6

Protein Details
Accession A0A177DBG6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
11-30SRNERAARKREYRDGKPPKEBasic
NLS Segment(s)
Subcellular Location(s) plas 15, E.R. 6, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR046529  DUF6594  
Gene Ontology GO:0016020  C:membrane  
KEGG aalt:CC77DRAFT_1078075  -  
Pfam View protein in Pfam  
PF20237  DUF6594  
Amino Acid Sequences MERLPVWMTYSRNERAARKREYRDGKPPKEVSGSVDRLCRFIIAAIGGLFLVGPMLIMAIRPSTAKSLITVSASVFLFAVVLTFGVRVTNIEGLVSTATYVAVLVVFVGSSTGGGSEVARLASNGTVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.54
3 0.61
4 0.64
5 0.66
6 0.7
7 0.74
8 0.78
9 0.77
10 0.78
11 0.8
12 0.77
13 0.77
14 0.72
15 0.66
16 0.61
17 0.54
18 0.48
19 0.46
20 0.44
21 0.37
22 0.39
23 0.36
24 0.32
25 0.32
26 0.26
27 0.18
28 0.13
29 0.12
30 0.08
31 0.08
32 0.07
33 0.07
34 0.06
35 0.06
36 0.05
37 0.04
38 0.03
39 0.02
40 0.02
41 0.01
42 0.02
43 0.02
44 0.02
45 0.02
46 0.03
47 0.03
48 0.04
49 0.04
50 0.06
51 0.07
52 0.07
53 0.08
54 0.09
55 0.1
56 0.1
57 0.1
58 0.09
59 0.11
60 0.11
61 0.1
62 0.09
63 0.07
64 0.07
65 0.06
66 0.06
67 0.03
68 0.03
69 0.03
70 0.03
71 0.03
72 0.03
73 0.04
74 0.04
75 0.06
76 0.07
77 0.07
78 0.07
79 0.07
80 0.07
81 0.08
82 0.07
83 0.06
84 0.04
85 0.04
86 0.04
87 0.04
88 0.04
89 0.03
90 0.03
91 0.03
92 0.03
93 0.03
94 0.03
95 0.03
96 0.03
97 0.03
98 0.03
99 0.04
100 0.04
101 0.05
102 0.05
103 0.06
104 0.07
105 0.08
106 0.08
107 0.08
108 0.09