Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177D462

Protein Details
Accession A0A177D462   
Localization Confidence High
Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MGAKRAPKQSPKRAREEEDDBasic
27-50AFGTPPPKRPAKKAKRPASSKTATHydrophilic
NLS Segment(s)
PositionSequence
32-81PPKRPAKKAKRPASSKTATKKPAKLKNTPAQKPTAAPPLLPSSRPSRTRR
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR028020  ASX_DEUBAD_dom  
KEGG aalt:CC77DRAFT_949257  -  
Pfam View protein in Pfam  
PF13919  ASXH  
Amino Acid Sequences MGAKRAPKQSPKRAREEEDDEEEEEEAFGTPPPKRPAKKAKRPASSKTATKKPAKLKNTPAQKPTAAPPLLPSSRPSRTRRAPERFEDLEEKTTSKALPAKKGASKVFDPVYITTNSSSRLVKADVYHMLLERPAWNSLTASQQSTLISMLPESPDNVNLLAKISAGETVDTRPAAFTLANNCFRTDVAKFQEDLKNGHLAKTWQAAAEQAVVERAAGEYDGWKAEEAEAWWGQKGM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.8
3 0.77
4 0.73
5 0.69
6 0.64
7 0.55
8 0.47
9 0.41
10 0.32
11 0.24
12 0.17
13 0.1
14 0.08
15 0.09
16 0.11
17 0.13
18 0.21
19 0.28
20 0.36
21 0.4
22 0.49
23 0.59
24 0.67
25 0.76
26 0.79
27 0.83
28 0.85
29 0.88
30 0.85
31 0.83
32 0.8
33 0.77
34 0.75
35 0.74
36 0.72
37 0.73
38 0.74
39 0.74
40 0.76
41 0.75
42 0.74
43 0.75
44 0.75
45 0.78
46 0.76
47 0.7
48 0.65
49 0.6
50 0.53
51 0.48
52 0.48
53 0.37
54 0.31
55 0.3
56 0.33
57 0.33
58 0.31
59 0.29
60 0.27
61 0.34
62 0.42
63 0.43
64 0.45
65 0.52
66 0.62
67 0.69
68 0.72
69 0.71
70 0.68
71 0.71
72 0.64
73 0.59
74 0.53
75 0.45
76 0.39
77 0.34
78 0.3
79 0.22
80 0.21
81 0.17
82 0.15
83 0.18
84 0.17
85 0.23
86 0.26
87 0.3
88 0.32
89 0.38
90 0.37
91 0.36
92 0.34
93 0.31
94 0.29
95 0.25
96 0.23
97 0.19
98 0.19
99 0.16
100 0.16
101 0.13
102 0.13
103 0.13
104 0.13
105 0.13
106 0.11
107 0.11
108 0.11
109 0.12
110 0.12
111 0.13
112 0.13
113 0.14
114 0.14
115 0.13
116 0.12
117 0.11
118 0.11
119 0.1
120 0.1
121 0.09
122 0.09
123 0.1
124 0.1
125 0.11
126 0.16
127 0.15
128 0.15
129 0.14
130 0.15
131 0.14
132 0.14
133 0.13
134 0.08
135 0.07
136 0.06
137 0.07
138 0.07
139 0.07
140 0.08
141 0.08
142 0.09
143 0.09
144 0.1
145 0.09
146 0.08
147 0.09
148 0.08
149 0.08
150 0.07
151 0.07
152 0.07
153 0.07
154 0.08
155 0.07
156 0.08
157 0.11
158 0.1
159 0.1
160 0.09
161 0.09
162 0.1
163 0.09
164 0.1
165 0.15
166 0.22
167 0.28
168 0.29
169 0.29
170 0.29
171 0.29
172 0.3
173 0.25
174 0.25
175 0.24
176 0.26
177 0.26
178 0.31
179 0.36
180 0.35
181 0.35
182 0.31
183 0.33
184 0.31
185 0.32
186 0.29
187 0.26
188 0.28
189 0.3
190 0.28
191 0.21
192 0.21
193 0.21
194 0.19
195 0.2
196 0.16
197 0.11
198 0.11
199 0.11
200 0.1
201 0.09
202 0.08
203 0.06
204 0.06
205 0.07
206 0.07
207 0.09
208 0.1
209 0.11
210 0.11
211 0.12
212 0.12
213 0.14
214 0.14
215 0.18
216 0.19
217 0.2