Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A177E2N2

Protein Details
Accession A0A177E2N2    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
5-36LRPPSYRTGARRDRIRRKRSKGPKRVRIARELBasic
NLS Segment(s)
PositionSequence
13-33GARRDRIRRKRSKGPKRVRIA
Subcellular Location(s) nucl 13, mito 9, cyto_nucl 9
Family & Domain DBs
KEGG aalt:CC77DRAFT_1015337  -  
Amino Acid Sequences MHSYLRPPSYRTGARRDRIRRKRSKGPKRVRIARELVRNIYHARLGGPLLRLEEDGFILAALCALLLDTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.71
3 0.75
4 0.78
5 0.81
6 0.87
7 0.87
8 0.86
9 0.89
10 0.9
11 0.91
12 0.9
13 0.91
14 0.9
15 0.89
16 0.9
17 0.83
18 0.79
19 0.74
20 0.69
21 0.66
22 0.59
23 0.51
24 0.42
25 0.4
26 0.34
27 0.29
28 0.23
29 0.15
30 0.13
31 0.12
32 0.12
33 0.12
34 0.12
35 0.12
36 0.13
37 0.13
38 0.13
39 0.13
40 0.12
41 0.1
42 0.09
43 0.08
44 0.07
45 0.06
46 0.05
47 0.05
48 0.04
49 0.03
50 0.03