Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A177DFE3

Protein Details
Accession A0A177DFE3    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPISKKDRIQREHKKADKAGBasic
NLS Segment(s)
PositionSequence
8-26RIQREHKKADKAGTRAPVK
Subcellular Location(s) nucl 19.5, mito_nucl 12.666, cyto_nucl 12.333, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR026939  ZNF706/At2g23090_sf  
KEGG aalt:CC77DRAFT_1063537  -  
Amino Acid Sequences MPISKKDRIQREHKKADKAGTRAPVKANGLPVKPPKPTSICQNCRREIVNTNKAQLEAHAASHDATTWPKEKCWPNDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.78
3 0.79
4 0.75
5 0.69
6 0.65
7 0.62
8 0.58
9 0.52
10 0.5
11 0.45
12 0.41
13 0.37
14 0.38
15 0.33
16 0.31
17 0.34
18 0.38
19 0.37
20 0.36
21 0.36
22 0.34
23 0.34
24 0.35
25 0.39
26 0.44
27 0.49
28 0.55
29 0.6
30 0.58
31 0.56
32 0.56
33 0.49
34 0.46
35 0.48
36 0.48
37 0.43
38 0.44
39 0.42
40 0.41
41 0.37
42 0.3
43 0.26
44 0.18
45 0.17
46 0.15
47 0.14
48 0.15
49 0.14
50 0.15
51 0.1
52 0.11
53 0.14
54 0.19
55 0.2
56 0.21
57 0.3
58 0.38