Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2WZI8

Protein Details
Accession G2WZI8   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
194-215PTNGDAKKRKPGRPPKAAAANGHydrophilic
NLS Segment(s)
PositionSequence
199-212AKKRKPGRPPKAAA
229-256EGLGEKLAKKVKKVLPAPGKTARKTRSQ
Subcellular Location(s) cyto 23, pero 2
Family & Domain DBs
KEGG vda:VDAG_03430  -  
Amino Acid Sequences MDANPAPGAVPAVAGIDKVVAEPAAAAPATAIDAPATAANPTAADDAKTADEQPAAPAVPAAAAAPKAATVEDASDKGTPVAVSGAAEPSKPIPGLTSSEAAAPVTAETTATEGVKDAAAAEPADKTDVTADELVQDKPVGVNGVASPSKDAEMTGALKETDAAPAAAPVTEEPAAAAAPADKPTDPEGDGAAPTNGDAKKRKPGRPPKAAAANGTENGNGHGHGEDKEGLGEKLAKKVKKVLPAPGKTARKTRSQGPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.07
4 0.07
5 0.07
6 0.07
7 0.05
8 0.05
9 0.06
10 0.06
11 0.08
12 0.07
13 0.07
14 0.06
15 0.06
16 0.08
17 0.07
18 0.07
19 0.05
20 0.05
21 0.06
22 0.07
23 0.07
24 0.06
25 0.07
26 0.07
27 0.07
28 0.08
29 0.09
30 0.09
31 0.1
32 0.1
33 0.11
34 0.13
35 0.13
36 0.13
37 0.12
38 0.13
39 0.12
40 0.13
41 0.13
42 0.11
43 0.1
44 0.1
45 0.08
46 0.07
47 0.07
48 0.06
49 0.05
50 0.05
51 0.05
52 0.05
53 0.06
54 0.06
55 0.06
56 0.06
57 0.05
58 0.07
59 0.09
60 0.1
61 0.11
62 0.11
63 0.12
64 0.11
65 0.11
66 0.09
67 0.07
68 0.07
69 0.06
70 0.06
71 0.06
72 0.09
73 0.08
74 0.08
75 0.09
76 0.09
77 0.1
78 0.09
79 0.09
80 0.08
81 0.09
82 0.13
83 0.14
84 0.14
85 0.13
86 0.14
87 0.14
88 0.13
89 0.11
90 0.08
91 0.05
92 0.05
93 0.04
94 0.04
95 0.04
96 0.05
97 0.06
98 0.05
99 0.05
100 0.05
101 0.06
102 0.06
103 0.05
104 0.05
105 0.04
106 0.05
107 0.05
108 0.05
109 0.05
110 0.05
111 0.06
112 0.05
113 0.05
114 0.05
115 0.06
116 0.07
117 0.07
118 0.07
119 0.08
120 0.09
121 0.09
122 0.09
123 0.08
124 0.07
125 0.06
126 0.07
127 0.06
128 0.04
129 0.05
130 0.05
131 0.09
132 0.09
133 0.09
134 0.09
135 0.09
136 0.1
137 0.09
138 0.09
139 0.06
140 0.08
141 0.09
142 0.08
143 0.09
144 0.08
145 0.08
146 0.09
147 0.08
148 0.07
149 0.06
150 0.06
151 0.05
152 0.06
153 0.06
154 0.06
155 0.05
156 0.05
157 0.07
158 0.07
159 0.07
160 0.07
161 0.07
162 0.07
163 0.06
164 0.06
165 0.04
166 0.05
167 0.07
168 0.08
169 0.08
170 0.1
171 0.12
172 0.14
173 0.14
174 0.14
175 0.14
176 0.13
177 0.14
178 0.13
179 0.11
180 0.09
181 0.08
182 0.13
183 0.13
184 0.17
185 0.21
186 0.24
187 0.34
188 0.43
189 0.5
190 0.56
191 0.66
192 0.72
193 0.78
194 0.81
195 0.79
196 0.8
197 0.75
198 0.67
199 0.62
200 0.55
201 0.46
202 0.41
203 0.32
204 0.23
205 0.22
206 0.2
207 0.15
208 0.11
209 0.11
210 0.11
211 0.12
212 0.14
213 0.13
214 0.13
215 0.15
216 0.15
217 0.15
218 0.15
219 0.2
220 0.19
221 0.26
222 0.33
223 0.34
224 0.35
225 0.45
226 0.49
227 0.53
228 0.57
229 0.58
230 0.62
231 0.65
232 0.7
233 0.7
234 0.73
235 0.68
236 0.72
237 0.66
238 0.65
239 0.65