Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2WYM0

Protein Details
Accession G2WYM0    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
222-241AAPAKKAKTGEKRRATLREKBasic
NLS Segment(s)
PositionSequence
210-241PLPPADEKKAATAAPAKKAKTGEKRRATLREK
Subcellular Location(s) cyto 11.5, cyto_nucl 11, nucl 9.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036249  Thioredoxin-like_sf  
KEGG vda:VDAG_03112  -  
Amino Acid Sequences MEMDKTSPNLTTSILSLLFRDDPIQDSPGGTATFFSDPIMTTFSTDPALYIFTSLTAGSSHIVTATSRLETILRANRVPFKAVDLATDQKARMLWGRRAGKDASGRVRKLPGLAQEGLILGDLVEIEDWNEYGELRQHVKIYYDEFTIPTIHNKPKDPPKRFVHPITGAPVKGGSKAGSKAAAGAAAAAAAASASSSSSAKPAAPPAAPPLPPADEKKAATAAPAKKAKTGEKRRATLREKVHISEAKGTKGQD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.15
4 0.17
5 0.17
6 0.16
7 0.16
8 0.14
9 0.16
10 0.18
11 0.2
12 0.17
13 0.16
14 0.17
15 0.18
16 0.17
17 0.14
18 0.12
19 0.13
20 0.13
21 0.13
22 0.13
23 0.1
24 0.11
25 0.12
26 0.14
27 0.11
28 0.12
29 0.13
30 0.13
31 0.14
32 0.13
33 0.12
34 0.1
35 0.12
36 0.09
37 0.09
38 0.08
39 0.07
40 0.08
41 0.08
42 0.07
43 0.06
44 0.07
45 0.07
46 0.07
47 0.07
48 0.06
49 0.07
50 0.07
51 0.08
52 0.09
53 0.09
54 0.09
55 0.1
56 0.1
57 0.1
58 0.16
59 0.21
60 0.22
61 0.22
62 0.25
63 0.31
64 0.32
65 0.33
66 0.27
67 0.24
68 0.25
69 0.24
70 0.23
71 0.21
72 0.22
73 0.23
74 0.24
75 0.2
76 0.17
77 0.17
78 0.16
79 0.18
80 0.21
81 0.23
82 0.3
83 0.37
84 0.36
85 0.39
86 0.39
87 0.38
88 0.38
89 0.39
90 0.39
91 0.39
92 0.39
93 0.38
94 0.4
95 0.35
96 0.32
97 0.29
98 0.25
99 0.23
100 0.22
101 0.21
102 0.19
103 0.19
104 0.17
105 0.14
106 0.09
107 0.04
108 0.03
109 0.03
110 0.02
111 0.02
112 0.02
113 0.02
114 0.03
115 0.03
116 0.03
117 0.03
118 0.03
119 0.03
120 0.06
121 0.08
122 0.1
123 0.11
124 0.12
125 0.13
126 0.14
127 0.15
128 0.15
129 0.15
130 0.14
131 0.14
132 0.13
133 0.14
134 0.13
135 0.13
136 0.14
137 0.18
138 0.22
139 0.25
140 0.26
141 0.32
142 0.42
143 0.52
144 0.53
145 0.57
146 0.59
147 0.64
148 0.68
149 0.65
150 0.62
151 0.56
152 0.52
153 0.49
154 0.46
155 0.37
156 0.31
157 0.29
158 0.21
159 0.19
160 0.17
161 0.13
162 0.13
163 0.15
164 0.16
165 0.15
166 0.15
167 0.15
168 0.14
169 0.13
170 0.09
171 0.08
172 0.06
173 0.05
174 0.04
175 0.03
176 0.03
177 0.02
178 0.02
179 0.02
180 0.02
181 0.02
182 0.04
183 0.05
184 0.05
185 0.07
186 0.08
187 0.09
188 0.11
189 0.14
190 0.17
191 0.17
192 0.18
193 0.24
194 0.28
195 0.28
196 0.27
197 0.27
198 0.27
199 0.3
200 0.34
201 0.34
202 0.34
203 0.35
204 0.37
205 0.36
206 0.32
207 0.32
208 0.36
209 0.34
210 0.38
211 0.43
212 0.41
213 0.43
214 0.48
215 0.54
216 0.57
217 0.63
218 0.64
219 0.68
220 0.73
221 0.77
222 0.83
223 0.79
224 0.77
225 0.74
226 0.74
227 0.69
228 0.65
229 0.65
230 0.6
231 0.58
232 0.59
233 0.53
234 0.48