Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A177D1L9

Protein Details
Accession A0A177D1L9   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
31-57YSVLKPTSSKIKKRQKYDEKRAARPADHydrophilic
NLS Segment(s)
PositionSequence
41-46IKKRQK
158-168AGGKKKKKGKK
Subcellular Location(s) nucl 13.5, mito 10, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR039914  SRP9-like  
IPR039432  SRP9_dom  
Gene Ontology GO:0048500  C:signal recognition particle  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
KEGG aalt:CC77DRAFT_1014859  -  
Pfam View protein in Pfam  
PF05486  SRP9-21  
Amino Acid Sequences MPYFDTSAEWYEQSSLLLKARPTSTRITSKYSVLKPTSSKIKKRQKYDEKRAARPADTSRASSPPPQSQNPEEVTVFFTLKTYDPESGTCLQYETNKGAEVGRLIGNLGRLGRHMAALPETMEDLSMPAGGEGASTPQVDEGGDVKMGGVPAAGTGGAGGKKKKKGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.16
4 0.18
5 0.18
6 0.21
7 0.25
8 0.27
9 0.28
10 0.32
11 0.37
12 0.43
13 0.45
14 0.48
15 0.46
16 0.49
17 0.54
18 0.53
19 0.53
20 0.46
21 0.47
22 0.43
23 0.46
24 0.52
25 0.51
26 0.56
27 0.59
28 0.68
29 0.71
30 0.78
31 0.83
32 0.83
33 0.86
34 0.88
35 0.89
36 0.86
37 0.85
38 0.84
39 0.77
40 0.67
41 0.6
42 0.54
43 0.51
44 0.45
45 0.41
46 0.34
47 0.33
48 0.34
49 0.34
50 0.34
51 0.33
52 0.36
53 0.36
54 0.38
55 0.37
56 0.4
57 0.37
58 0.35
59 0.27
60 0.23
61 0.22
62 0.19
63 0.17
64 0.12
65 0.1
66 0.09
67 0.09
68 0.11
69 0.11
70 0.11
71 0.11
72 0.12
73 0.15
74 0.16
75 0.16
76 0.14
77 0.12
78 0.12
79 0.13
80 0.15
81 0.13
82 0.12
83 0.12
84 0.12
85 0.12
86 0.12
87 0.1
88 0.1
89 0.09
90 0.08
91 0.08
92 0.08
93 0.08
94 0.09
95 0.09
96 0.07
97 0.07
98 0.09
99 0.09
100 0.09
101 0.09
102 0.09
103 0.1
104 0.1
105 0.1
106 0.09
107 0.09
108 0.08
109 0.08
110 0.07
111 0.06
112 0.05
113 0.05
114 0.05
115 0.04
116 0.04
117 0.04
118 0.04
119 0.04
120 0.06
121 0.07
122 0.07
123 0.07
124 0.07
125 0.08
126 0.07
127 0.09
128 0.08
129 0.08
130 0.08
131 0.08
132 0.08
133 0.09
134 0.09
135 0.08
136 0.06
137 0.05
138 0.05
139 0.06
140 0.05
141 0.04
142 0.04
143 0.07
144 0.1
145 0.14
146 0.21
147 0.28
148 0.37